(data stored in ACNUC7421 zone)

EMBL: CP001053.PE383

CP001053.PE383       Location/Qualifiers
FT   CDS             complement(438866..439630)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4381"
FT                   /product="transcriptional regulator, IclR family"
FT                   /note="PFAM: regulatory protein IclR; Transcriptional
FT                   regulator IclR; KEGG: bxe:Bxe_B0700 transcriptional
FT                   regulator, IclR family"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4381"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18758"
FT                   /db_xref="GOA:B2TF87"
FT                   /db_xref="InterPro:IPR005471"
FT                   /db_xref="InterPro:IPR014757"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B2TF87"
FT                   /protein_id="ACD18758.1"
FT                   /translation="MSTSNQSNAAAVRAFRVLETLAEAGSPLSMTELVNALGLPKQTVH
FT                   RILVQLMDAWLVTRGAGDRLYECSPRVRMLAVNVLMHAGPAAARHVLLEQLVAKIGETC
FT                   NLTMLSGNDVVYVDRVETEWPLRMHLQPGSHVPLHCSASGKLLLSFLPKDRRERVIETL
FT                   PLRGYSERTITDRDALRKELSTTRRRLLAINNQEHLQGLIAIAVPVMLDRNRACAAIAV
FT                   QAPVGRVTLDDLLAFVPDLRHAAEETAKTFQE"
     MSTSNQSNAA AVRAFRVLET LAEAGSPLSM TELVNALGLP KQTVHRILVQ LMDAWLVTRG        60
     AGDRLYECSP RVRMLAVNVL MHAGPAAARH VLLEQLVAKI GETCNLTMLS GNDVVYVDRV       120
     ETEWPLRMHL QPGSHVPLHC SASGKLLLSF LPKDRRERVI ETLPLRGYSE RTITDRDALR       180
     KELSTTRRRL LAINNQEHLQ GLIAIAVPVM LDRNRACAAI AVQAPVGRVT LDDLLAFVPD       240
     LRHAAEETAK TFQE                                                         254
//

If you have problems or comments...

PBIL Back to PBIL home page