(data stored in ACNUC7421 zone)

EMBL: CP001053.PE387

CP001053.PE387       Location/Qualifiers
FT   CDS             444824..445156
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4385"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: bmu:Bmul_6287 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4385"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18762"
FT                   /db_xref="InterPro:IPR025421"
FT                   /db_xref="UniProtKB/TrEMBL:B2TF91"
FT                   /protein_id="ACD18762.1"
FT                   /translation="MKFRKVFVIGLLGAFLSPLALADVGHASPGHAPVKQDGSYGSVPQ
FT                   TTLPSSAAPVVKPAAQGKTRAEVRQELLQAYKDGLIPTTEADYPPSKRTIERNKALFAE
FT                   TERYLE"
     MKFRKVFVIG LLGAFLSPLA LADVGHASPG HAPVKQDGSY GSVPQTTLPS SAAPVVKPAA        60
     QGKTRAEVRQ ELLQAYKDGL IPTTEADYPP SKRTIERNKA LFAETERYLE                  110
//

If you have problems or comments...

PBIL Back to PBIL home page