(data stored in ACNUC7421 zone)

EMBL: CP001053.PE388

CP001053.PE388       Location/Qualifiers
FT   CDS             445245..445583
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4386"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bur:Bcep18194_B0467 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4386"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18763"
FT                   /db_xref="InterPro:IPR025421"
FT                   /db_xref="UniProtKB/TrEMBL:B2TF92"
FT                   /protein_id="ACD18763.1"
FT                   /translation="MKSIISLALASAVFVTSAVQAQGLTRAEVKQQLIEAQANGLRYVT
FT                   ESSYPDVHPSFAHKVKAKAATPSAQSDEGGVPAGSHESGSAPHGLPMPEGNPHCVGPVS
FT                   FCNIYAGS"
     MKSIISLALA SAVFVTSAVQ AQGLTRAEVK QQLIEAQANG LRYVTESSYP DVHPSFAHKV        60
     KAKAATPSAQ SDEGGVPAGS HESGSAPHGL PMPEGNPHCV GPVSFCNIYA GS               112
//

If you have problems or comments...

PBIL Back to PBIL home page