(data stored in ACNUC7421 zone)

EMBL: CP001053.PE39

CP001053.PE39        Location/Qualifiers
FT   CDS             complement(43885..44202)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4028"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bxe:Bxe_B0489 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4028"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18414"
FT                   /db_xref="InterPro:IPR025421"
FT                   /db_xref="UniProtKB/TrEMBL:B2TE93"
FT                   /protein_id="ACD18414.1"
FT                   /translation="MKSLIQAVVIAAVLAAPVASFAQSNQPVTRAQVRAELIQLEKAGY
FT                   QPGLADPYYPADIQAAQARVARENGTAQAAESGYGGTVSGASQAGRPVPANGPQSVYFG
FT                   H"
     MKSLIQAVVI AAVLAAPVAS FAQSNQPVTR AQVRAELIQL EKAGYQPGLA DPYYPADIQA        60
     AQARVARENG TAQAAESGYG GTVSGASQAG RPVPANGPQS VYFGH                       105
//

If you have problems or comments...

PBIL Back to PBIL home page