(data stored in ACNUC7421 zone)

EMBL: CP001053.PE393

CP001053.PE393       Location/Qualifiers
FT   CDS             450848..451132
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4392"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bxe:Bxe_B0711 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4392"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18768"
FT                   /db_xref="InterPro:IPR025421"
FT                   /db_xref="UniProtKB/TrEMBL:B2TF97"
FT                   /protein_id="ACD18768.1"
FT                   /translation="MKSLIQAVVVAAVLAAPVAVFAQTNSPVTRAQVRAELIELEQAGY
FT                   NPGRGEDPNYPADIQAAEARVAARHAATGFGGSASGSSEAGRAPVSNSD"
     MKSLIQAVVV AAVLAAPVAV FAQTNSPVTR AQVRAELIEL EQAGYNPGRG EDPNYPADIQ        60
     AAEARVAARH AATGFGGSAS GSSEAGRAPV SNSD                                    94
//

If you have problems or comments...

PBIL Back to PBIL home page