(data stored in ACNUC7421 zone)

EMBL: CP001053.PE394

CP001053.PE394       Location/Qualifiers
FT   CDS             451472..451903
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4393"
FT                   /product="response regulator receiver protein"
FT                   /note="PFAM: response regulator receiver; KEGG:
FT                   bxe:Bxe_B0713 response regulator receiver domain
FT                   protein(CheY)"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4393"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18769"
FT                   /db_xref="GOA:B2TF98"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="UniProtKB/TrEMBL:B2TF98"
FT                   /protein_id="ACD18769.1"
FT                   /translation="MPRTPATCQRWSAREIRVLHELPRVLVVDDNVGAAEALATYLSYE
FT                   GVEARAADGCEQALRCVRDWVPDVVVLDIMMPERDGYETASALRSYLPTQSLGIVAFTS
FT                   LDEDHVKETGKARHNFDGYCQKGTAPTALLALMRKLWRE"
     MPRTPATCQR WSAREIRVLH ELPRVLVVDD NVGAAEALAT YLSYEGVEAR AADGCEQALR        60
     CVRDWVPDVV VLDIMMPERD GYETASALRS YLPTQSLGIV AFTSLDEDHV KETGKARHNF       120
     DGYCQKGTAP TALLALMRKL WRE                                               143
//

If you have problems or comments...

PBIL Back to PBIL home page