(data stored in ACNUC7421 zone)

EMBL: CP001053.PE395

CP001053.PE395       Location/Qualifiers
FT   CDS             complement(451943..452272)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4394"
FT                   /product="transcriptional regulator, ArsR family"
FT                   /note="PFAM: regulatory protein ArsR; KEGG: bxe:Bxe_B0714
FT                   transcriptional regulator, ArsR family"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4394"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18770"
FT                   /db_xref="GOA:B2TF99"
FT                   /db_xref="InterPro:IPR001845"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B2TF99"
FT                   /protein_id="ACD18770.1"
FT                   /translation="MRTYNHPAAEDFALGRLFHALSDPVRLEIVRRLASVDEATCGELD
FT                   GGRPKSSVSHHFRILREAGLVRTRVAGTVHQNSLRRAELDARFPGLMEAILKQIVAETA
FT                   ESEPA"
     MRTYNHPAAE DFALGRLFHA LSDPVRLEIV RRLASVDEAT CGELDGGRPK SSVSHHFRIL        60
     REAGLVRTRV AGTVHQNSLR RAELDARFPG LMEAILKQIV AETAESEPA                   109
//

If you have problems or comments...

PBIL Back to PBIL home page