(data stored in ACNUC7421 zone)

EMBL: CP001053.PE397

CP001053.PE397       Location/Qualifiers
FT   CDS             454309..455337
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4396"
FT                   /product="transcriptional regulator, MerR family"
FT                   /note="PFAM: regulatory protein MerR; KEGG:
FT                   bvi:Bcep1808_5897 putative transcriptional regulator, MerR
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4396"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18772"
FT                   /db_xref="GOA:B2TFA1"
FT                   /db_xref="InterPro:IPR000551"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="UniProtKB/TrEMBL:B2TFA1"
FT                   /protein_id="ACD18772.1"
FT                   /translation="MTSSDEQRPAQQGYRSGEAARLAKMPVTTLRIWERRYGVVGPAKT
FT                   ASGQRLYTEDDVRRLTLIKLLVSRGHAIGAIARLDREQLQFLAARSGRESGGATDLPLV
FT                   ESVNLRLALVGGSLAQRFRASGVDLRPYGVNELITFADLSLAAAGGGTSGERGAPIDAL
FT                   LVSIDSLQEDIASQIIALGDAVRAKAIAVVYGFGTGPAAEILRVAGVRLYREPDSRTEF
FT                   RQMLGDLCERVRSQERIGDDAVWSRVRRRYDDRELEMIAGRSSTIACECPRHLAELVMK
FT                   LSAFERYSDACTSRSAQDAALHRYLGDVSNRACAMVEAALERVAREEGWFAGSQSPQAG
FT                   QA"
     MTSSDEQRPA QQGYRSGEAA RLAKMPVTTL RIWERRYGVV GPAKTASGQR LYTEDDVRRL        60
     TLIKLLVSRG HAIGAIARLD REQLQFLAAR SGRESGGATD LPLVESVNLR LALVGGSLAQ       120
     RFRASGVDLR PYGVNELITF ADLSLAAAGG GTSGERGAPI DALLVSIDSL QEDIASQIIA       180
     LGDAVRAKAI AVVYGFGTGP AAEILRVAGV RLYREPDSRT EFRQMLGDLC ERVRSQERIG       240
     DDAVWSRVRR RYDDRELEMI AGRSSTIACE CPRHLAELVM KLSAFERYSD ACTSRSAQDA       300
     ALHRYLGDVS NRACAMVEAA LERVAREEGW FAGSQSPQAG QA                          342
//

If you have problems or comments...

PBIL Back to PBIL home page