(data stored in ACNUC7421 zone)

EMBL: CP001053.PE399

CP001053.PE399       Location/Qualifiers
FT   CDS             456173..456850
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4398"
FT                   /product="bifunctional deaminase-reductase domain protein"
FT                   /note="PFAM: bifunctional deaminase-reductase domain
FT                   protein; KEGG: bxe:Bxe_B0716 putative pyrimidine reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4398"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18774"
FT                   /db_xref="GOA:B2TFA3"
FT                   /db_xref="InterPro:IPR002734"
FT                   /db_xref="InterPro:IPR024072"
FT                   /db_xref="UniProtKB/TrEMBL:B2TFA3"
FT                   /protein_id="ACD18774.1"
FT                   /translation="MNPYIVAHMMSSLDGRSLTDGWHLDYASDLYEDTAATFEADGWIC
FT                   GRVTMQEIAHGADYPKGLAKGAVPRTDHFVERKADQYAISIDPQGRVAWKSNTALKSHV
FT                   IEVLTEQVADDYLAYLQSIGVSYVFGGKTELDLGKVVQTLARELGVKKLIVEGGSHVSG
FT                   AFVNAGLVDEVSVLILPLVDGRSEHPSSFEVAMEKWQAPAYLKLTSVEQKEHGAVWLRY
FT                   TKA"
     MNPYIVAHMM SSLDGRSLTD GWHLDYASDL YEDTAATFEA DGWICGRVTM QEIAHGADYP        60
     KGLAKGAVPR TDHFVERKAD QYAISIDPQG RVAWKSNTAL KSHVIEVLTE QVADDYLAYL       120
     QSIGVSYVFG GKTELDLGKV VQTLARELGV KKLIVEGGSH VSGAFVNAGL VDEVSVLILP       180
     LVDGRSEHPS SFEVAMEKWQ APAYLKLTSV EQKEHGAVWL RYTKA                       225
//

If you have problems or comments...

PBIL Back to PBIL home page