(data stored in ACNUC7421 zone)

EMBL: CP001053.PE403

CP001053.PE403       Location/Qualifiers
FT   CDS             460311..460760
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4402"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bxe:Bxe_B0721 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4402"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18778"
FT                   /db_xref="InterPro:IPR021267"
FT                   /db_xref="UniProtKB/TrEMBL:B2TFA7"
FT                   /protein_id="ACD18778.1"
FT                   /translation="MLYSRIARAMLGASCALSLAAHATLGQNVSTVNGDQSRLRAVTHT
FT                   ATTQSAYSVHLMTLPSGTLVREYVARNGIVFGVAWEGPTLPDLKSMLGTSFDAYVAATT
FT                   TRRGTPLAVSNSDLVVYSGGHLRAFSGHAYLPQTVPAGVDAGVIQ"
     MLYSRIARAM LGASCALSLA AHATLGQNVS TVNGDQSRLR AVTHTATTQS AYSVHLMTLP        60
     SGTLVREYVA RNGIVFGVAW EGPTLPDLKS MLGTSFDAYV AATTTRRGTP LAVSNSDLVV       120
     YSGGHLRAFS GHAYLPQTVP AGVDAGVIQ                                         149
//

If you have problems or comments...

PBIL Back to PBIL home page