(data stored in ACNUC7421 zone)

EMBL: CP001053.PE404

CP001053.PE404       Location/Qualifiers
FT   CDS             460772..462049
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4403"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bxe:Bxe_B0722 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4403"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18779"
FT                   /db_xref="InterPro:IPR021847"
FT                   /db_xref="UniProtKB/TrEMBL:B2TFA8"
FT                   /protein_id="ACD18779.1"
FT                   /translation="MRLMSSFKTLLCAALLALLVGACGGGGGGSSGSGSAAGTNGSTSA
FT                   SPGPSVANTVPLSQTLAANAVRVTVDSGVSDVPNMPFVNLTICAPGTTQCQTIDHVLVD
FT                   TGSWGVRLFASQLPASMTLPQQKDTSGHLVAECMQFFDGYTWGPVKLADLQIAGEKAAS
FT                   LPIQVIDPNYATLPADCANFGAARNTPATLQANGILGIGVFKHDCGANCVQQALAGTYY
FT                   GCNGATCTSIPLAEELQVANPVPYFATDNNGSLLSLPAVSGGAQSVSGQLIFGIGTQTN
FT                   NALGGAQVIGVSPSNGTFTTVQNGITYPRSILDSGSTGLFFQTSALPVCASPNNSYYCP
FT                   GSTQQLSAMIQGVNGTTSAVNFSVGNATTIAQTYSGDSALPLLAGPAFVQSAIFDWGLP
FT                   FFYGRSVYAAVEQQPTPGGMGPYVAY"
     MRLMSSFKTL LCAALLALLV GACGGGGGGS SGSGSAAGTN GSTSASPGPS VANTVPLSQT        60
     LAANAVRVTV DSGVSDVPNM PFVNLTICAP GTTQCQTIDH VLVDTGSWGV RLFASQLPAS       120
     MTLPQQKDTS GHLVAECMQF FDGYTWGPVK LADLQIAGEK AASLPIQVID PNYATLPADC       180
     ANFGAARNTP ATLQANGILG IGVFKHDCGA NCVQQALAGT YYGCNGATCT SIPLAEELQV       240
     ANPVPYFATD NNGSLLSLPA VSGGAQSVSG QLIFGIGTQT NNALGGAQVI GVSPSNGTFT       300
     TVQNGITYPR SILDSGSTGL FFQTSALPVC ASPNNSYYCP GSTQQLSAMI QGVNGTTSAV       360
     NFSVGNATTI AQTYSGDSAL PLLAGPAFVQ SAIFDWGLPF FYGRSVYAAV EQQPTPGGMG       420
     PYVAY                                                                   425
//

If you have problems or comments...

PBIL Back to PBIL home page