(data stored in ACNUC7421 zone)

EMBL: CP001053.PE406

CP001053.PE406       Location/Qualifiers
FT   CDS             complement(464317..465546)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4405"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bxe:Bxe_B0724 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4405"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18781"
FT                   /db_xref="InterPro:IPR011201"
FT                   /db_xref="InterPro:IPR031321"
FT                   /db_xref="UniProtKB/TrEMBL:B2TFB0"
FT                   /protein_id="ACD18781.1"
FT                   /translation="MKTFHCNHCSHLVFYENVRCERCESLLGYVPEVAEISAFEDAGEG
FT                   RWRSLHPGAEGALFRQCHNYAVENVCNWMIPADSPDQLCRACQLTLTIPNLSAPDNRLY
FT                   WYRLEMAKRRLLYTLAELGLDVKSRQVDPEHGLAFEFLEDGGDGSRVMTGHDNGLITLN
FT                   IAEADDAHREKVRTAMGEPYRTLLGHFRHETGHYYFSQLVENNPRWLEPFRKLFGDESV
FT                   DYGEALNAYYRDGAPAEWQASFISAYATMHPWEDWAETWAHYMLIVDVLDTSTSYGVAL
FT                   LPDDPSEPTLTDRTPVEDASFENLMKRWFPLTYALNSLNRSLGMPDGYPFTLAAPVVEK
FT                   LRFVHRVIQAAGDKSQPREAATPPGQAAVAPVQEAAAPQQQPVASEPPPLQPAPVAAQT
FT                   APAKRATRRR"
     MKTFHCNHCS HLVFYENVRC ERCESLLGYV PEVAEISAFE DAGEGRWRSL HPGAEGALFR        60
     QCHNYAVENV CNWMIPADSP DQLCRACQLT LTIPNLSAPD NRLYWYRLEM AKRRLLYTLA       120
     ELGLDVKSRQ VDPEHGLAFE FLEDGGDGSR VMTGHDNGLI TLNIAEADDA HREKVRTAMG       180
     EPYRTLLGHF RHETGHYYFS QLVENNPRWL EPFRKLFGDE SVDYGEALNA YYRDGAPAEW       240
     QASFISAYAT MHPWEDWAET WAHYMLIVDV LDTSTSYGVA LLPDDPSEPT LTDRTPVEDA       300
     SFENLMKRWF PLTYALNSLN RSLGMPDGYP FTLAAPVVEK LRFVHRVIQA AGDKSQPREA       360
     ATPPGQAAVA PVQEAAAPQQ QPVASEPPPL QPAPVAAQTA PAKRATRRR                   409
//

If you have problems or comments...

PBIL Back to PBIL home page