(data stored in ACNUC7421 zone)

EMBL: CP001053.PE408

CP001053.PE408       Location/Qualifiers
FT   CDS             469385..472021
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4407"
FT                   /product="protein of unknown function DUF404"
FT                   /note="PFAM: protein of unknown function DUF403; protein of
FT                   unknown function DUF404; protein of unknown function
FT                   DUF407; KEGG: bxe:Bxe_B0726 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4407"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18783"
FT                   /db_xref="InterPro:IPR007296"
FT                   /db_xref="InterPro:IPR025841"
FT                   /db_xref="UniProtKB/TrEMBL:B2TFB2"
FT                   /protein_id="ACD18783.1"
FT                   /translation="MAFQSTFPFETSAARADASSLLRLLPAHEGHWDELRDASGALREP
FT                   WRQFFERLGEDGIARLDDHLASVARQIRDNDISYNVYADNGEPRPWALDLLPFLISEEE
FT                   WAHIERGVTQRAHLLNAIVADIYGPQTLLERGQLPPALVFGHPGYLRSVKGYAPPGGQF
FT                   LQVVAVDLARTPDGDWTVMAHRTEAPSGLGYALENRLIVSTLFADPFRALRVSRLAPTY
FT                   SQLIATLVQAAQATMRHESDGADHSPHIALLTPGPFSETYFEHVFLARYLGVTLVEGKD
FT                   LTVRDDKLYLKTLAGLERVHVVLRRLDDAFCDPVELRADSSIGVPGLLQVMRAGNVIVS
FT                   NVPGSGFVESPALHGFLPGIAEVLLDEDLVLPSVATWWCGEEAAREHAFRRLDEAFIVP
FT                   TWPVAGRDAPPGVEQGRQRLSTWRERIEAMPDTYTIQQAQRFSCTPRYEDGTVGRRPSV
FT                   LRVYAIADVNGGWHVMPGGFTRMAAERQATVSMQYGGSSVDTWVLSSQPTSTFTLLPSP
FT                   MQPADLARKHRTVSSRAAENLFWAGRYGERAENNVRLLRLILGSLEGNDADAMFPTLVE
FT                   LALYCGLVQSGDMFAPHSPQAFERALVANLIESTGAASIGQNLTSQARSNGEVRGRLSN
FT                   DHWRTILAARNDFRDALQMLMPAPGYSNGSSSSQGNGNGRGERYERYDRVTLMSALEHL
FT                   SVQLSAISGAQGDRMTRDEAWRLLFVGRHIERVSAMTSFLRVVADKGQLSTPAGFDLLL
FT                   QLFDSTLTYRSLYPGRFEVPALLDLLVIEPTNPRGIYGVYERLRKKLDEIAVAAGSTRH
FT                   RPFAELMAPTDVLPTLESLCEVDENGTYANLIAVCDQIAGFVGAAGHEISARYFSHAST
FT                   VASQVWS"
     MAFQSTFPFE TSAARADASS LLRLLPAHEG HWDELRDASG ALREPWRQFF ERLGEDGIAR        60
     LDDHLASVAR QIRDNDISYN VYADNGEPRP WALDLLPFLI SEEEWAHIER GVTQRAHLLN       120
     AIVADIYGPQ TLLERGQLPP ALVFGHPGYL RSVKGYAPPG GQFLQVVAVD LARTPDGDWT       180
     VMAHRTEAPS GLGYALENRL IVSTLFADPF RALRVSRLAP TYSQLIATLV QAAQATMRHE       240
     SDGADHSPHI ALLTPGPFSE TYFEHVFLAR YLGVTLVEGK DLTVRDDKLY LKTLAGLERV       300
     HVVLRRLDDA FCDPVELRAD SSIGVPGLLQ VMRAGNVIVS NVPGSGFVES PALHGFLPGI       360
     AEVLLDEDLV LPSVATWWCG EEAAREHAFR RLDEAFIVPT WPVAGRDAPP GVEQGRQRLS       420
     TWRERIEAMP DTYTIQQAQR FSCTPRYEDG TVGRRPSVLR VYAIADVNGG WHVMPGGFTR       480
     MAAERQATVS MQYGGSSVDT WVLSSQPTST FTLLPSPMQP ADLARKHRTV SSRAAENLFW       540
     AGRYGERAEN NVRLLRLILG SLEGNDADAM FPTLVELALY CGLVQSGDMF APHSPQAFER       600
     ALVANLIEST GAASIGQNLT SQARSNGEVR GRLSNDHWRT ILAARNDFRD ALQMLMPAPG       660
     YSNGSSSSQG NGNGRGERYE RYDRVTLMSA LEHLSVQLSA ISGAQGDRMT RDEAWRLLFV       720
     GRHIERVSAM TSFLRVVADK GQLSTPAGFD LLLQLFDSTL TYRSLYPGRF EVPALLDLLV       780
     IEPTNPRGIY GVYERLRKKL DEIAVAAGST RHRPFAELMA PTDVLPTLES LCEVDENGTY       840
     ANLIAVCDQI AGFVGAAGHE ISARYFSHAS TVASQVWS                               878
//

If you have problems or comments...

PBIL Back to PBIL home page