(data stored in ACNUC7421 zone)

EMBL: CP001053.PE409

CP001053.PE409       Location/Qualifiers
FT   CDS             472018..472908
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4408"
FT                   /product="transglutaminase domain protein"
FT                   /note="PFAM: transglutaminase domain protein;
FT                   transglutaminase domain protein; KEGG: bxe:Bxe_B0727
FT                   transglutaminase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4408"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18784"
FT                   /db_xref="InterPro:IPR002931"
FT                   /db_xref="InterPro:IPR013589"
FT                   /db_xref="InterPro:IPR038765"
FT                   /db_xref="UniProtKB/TrEMBL:B2TFB3"
FT                   /protein_id="ACD18784.1"
FT                   /translation="MKHTPTVLSVSHRTTYRYSTFVETAQHLATIRPIACSWQRVVSHS
FT                   EKIEPEPSYMNSRIDAFGNDVLYFALDAPHERLQLVSETTVALMPRWTDLDPEATPAWD
FT                   DVADALRFRVGGRFRPEAEFCFASPNIVPRPSLRDYALPSFPPGMPVAAGAIDLMHRIH
FT                   EDFAYKPSATMFDTPAERAFELKSGVCQDFAQVMIGCLRSLGLPARYVSGYLRNDPPPG
FT                   QPRLIGADASHAWVSVYCPGSGWIDLDPTNDVLADMDHVTLAIGRDYSDVSLLRGMILG
FT                   GGAHRVEVGVTVLAL"
     MKHTPTVLSV SHRTTYRYST FVETAQHLAT IRPIACSWQR VVSHSEKIEP EPSYMNSRID        60
     AFGNDVLYFA LDAPHERLQL VSETTVALMP RWTDLDPEAT PAWDDVADAL RFRVGGRFRP       120
     EAEFCFASPN IVPRPSLRDY ALPSFPPGMP VAAGAIDLMH RIHEDFAYKP SATMFDTPAE       180
     RAFELKSGVC QDFAQVMIGC LRSLGLPARY VSGYLRNDPP PGQPRLIGAD ASHAWVSVYC       240
     PGSGWIDLDP TNDVLADMDH VTLAIGRDYS DVSLLRGMIL GGGAHRVEVG VTVLAL           296
//

If you have problems or comments...

PBIL Back to PBIL home page