(data stored in ACNUC7421 zone)

EMBL: CP001053.PE410

CP001053.PE410       Location/Qualifiers
FT   CDS             473096..473845
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4409"
FT                   /product="transcriptional regulator, IclR family"
FT                   /note="PFAM: regulatory protein ArsR; regulatory protein
FT                   IclR; Transcriptional regulator IclR; KEGG: bxe:Bxe_B2051
FT                   transcriptional regulator, IclR family"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4409"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18785"
FT                   /db_xref="GOA:B2TFB4"
FT                   /db_xref="InterPro:IPR005471"
FT                   /db_xref="InterPro:IPR014757"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B2TFB4"
FT                   /protein_id="ACD18785.1"
FT                   /translation="MNTEQGVTGAERVLLVLAALASHGKAMSVKELLAVTGLAQSTLYR
FT                   QIALLKRWGFVAENAGHYAPGPISLQLALGFDVNSLLVEASRSEMQRLARASQESIGLV
FT                   VAVKHQVMCLEMVDSQHSLRCSFEKGRAVALKAGASAKSLLAFMADKARTEVLDNLFND
FT                   DPAGRVAIEARLEQIRAQGYAVSDSEVDPGVWGVSAPIFHRSGRGAGSGASITLMAPST
FT                   RAVGRESQFIDGTLRTARAISERMQTD"
     MNTEQGVTGA ERVLLVLAAL ASHGKAMSVK ELLAVTGLAQ STLYRQIALL KRWGFVAENA        60
     GHYAPGPISL QLALGFDVNS LLVEASRSEM QRLARASQES IGLVVAVKHQ VMCLEMVDSQ       120
     HSLRCSFEKG RAVALKAGAS AKSLLAFMAD KARTEVLDNL FNDDPAGRVA IEARLEQIRA       180
     QGYAVSDSEV DPGVWGVSAP IFHRSGRGAG SGASITLMAP STRAVGRESQ FIDGTLRTAR       240
     AISERMQTD                                                               249
//

If you have problems or comments...

PBIL Back to PBIL home page