(data stored in ACNUC7421 zone)

EMBL: CP001053.PE415

CP001053.PE415       Location/Qualifiers
FT   CDS             477266..477688
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4414"
FT                   /product="transcriptional regulator, MarR family"
FT                   /note="PFAM: regulatory protein MarR; KEGG: bxe:Bxe_B0734
FT                   transcriptional regulator, MarR family"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4414"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18790"
FT                   /db_xref="GOA:B2TFB9"
FT                   /db_xref="InterPro:IPR000835"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B2TFB9"
FT                   /protein_id="ACD18790.1"
FT                   /translation="MNRPISYDECNCFALRQAARHVTQIYERHLGEVGLTAAQFTILAK
FT                   LARVPNLPMVDLADAMVMERTTLVRAMKPLQRDGLVAAEAAEHDGRTFLFSLTKKGETT
FT                   FDQAAIAWRAAQDEFEKKFGHARAKTLRAELFSITG"
     MNRPISYDEC NCFALRQAAR HVTQIYERHL GEVGLTAAQF TILAKLARVP NLPMVDLADA        60
     MVMERTTLVR AMKPLQRDGL VAAEAAEHDG RTFLFSLTKK GETTFDQAAI AWRAAQDEFE       120
     KKFGHARAKT LRAELFSITG                                                   140
//

If you have problems or comments...

PBIL Back to PBIL home page