(data stored in ACNUC7421 zone)

EMBL: CP001053.PE424

CP001053.PE424       Location/Qualifiers
FT   CDS             486725..487660
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4423"
FT                   /product="2-dehydropantoate 2-reductase"
FT                   /EC_number="1.1.1.169"
FT                   /note="KEGG: bxe:Bxe_B0743 ketopantoate reductase
FT                   ApbA/PanE; TIGRFAM: 2-dehydropantoate 2-reductase; PFAM:
FT                   Ketopantoate reductase ApbA/PanE domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4423"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18799"
FT                   /db_xref="GOA:B2TFC8"
FT                   /db_xref="InterPro:IPR003710"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR013328"
FT                   /db_xref="InterPro:IPR013332"
FT                   /db_xref="InterPro:IPR013752"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B2TFC8"
FT                   /protein_id="ACD18799.1"
FT                   /translation="MRILVVGAGAVGGYFGGRLAAAGQDVTFLVRPGRAEKLKRDGLVI
FT                   SSVRGDLKLPDPQTILAGVSAEPFDLVLLSCKAFSLDDAIDSFAPLVGESTLILPMLNG
FT                   MRHMEVLNEKFGAARVLGGQCVIAATLNAEQHIVHLNDTHAITFGEQAGGASERVQAIA
FT                   EAMGDANFDAVISDNILLRMWEKWVFLATLAGGTCLMRGSVGDILAAPDGKRVIENLLG
FT                   ECRAVAEHNGFTMGPDFDARATQTLFTPSPLTASMLRDVENHSHTEADHILGDLISRGG
FT                   DAQKGEHGLSLLRIAYSHLKTYEARQARTS"
     MRILVVGAGA VGGYFGGRLA AAGQDVTFLV RPGRAEKLKR DGLVISSVRG DLKLPDPQTI        60
     LAGVSAEPFD LVLLSCKAFS LDDAIDSFAP LVGESTLILP MLNGMRHMEV LNEKFGAARV       120
     LGGQCVIAAT LNAEQHIVHL NDTHAITFGE QAGGASERVQ AIAEAMGDAN FDAVISDNIL       180
     LRMWEKWVFL ATLAGGTCLM RGSVGDILAA PDGKRVIENL LGECRAVAEH NGFTMGPDFD       240
     ARATQTLFTP SPLTASMLRD VENHSHTEAD HILGDLISRG GDAQKGEHGL SLLRIAYSHL       300
     KTYEARQART S                                                            311
//

If you have problems or comments...

PBIL Back to PBIL home page