(data stored in ACNUC7421 zone)

EMBL: CP001053.PE425

CP001053.PE425       Location/Qualifiers
FT   CDS             487728..488027
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4424"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bxe:Bxe_B0744 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4424"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18800"
FT                   /db_xref="GOA:B2TFC9"
FT                   /db_xref="UniProtKB/TrEMBL:B2TFC9"
FT                   /protein_id="ACD18800.1"
FT                   /translation="MPTPIGSVPALSAASATIFSIGIVFLGYWGLYEPIQWRAADVFVF
FT                   VFALIGFGCLGLVPWVATSPVEPEGSDSRIRIARHLFLAGVAGIWLAVAMSVIF"
     MPTPIGSVPA LSAASATIFS IGIVFLGYWG LYEPIQWRAA DVFVFVFALI GFGCLGLVPW        60
     VATSPVEPEG SDSRIRIARH LFLAGVAGIW LAVAMSVIF                               99
//

If you have problems or comments...

PBIL Back to PBIL home page