(data stored in ACNUC7421 zone)

EMBL: CP001053.PE428

CP001053.PE428       Location/Qualifiers
FT   CDS             complement(490313..491746)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4427"
FT                   /product="BFD domain protein (2Fe-2S)-binding domain
FT                   protein"
FT                   /note="PFAM: BFD domain protein [2Fe-2S]-binding domain
FT                   protein; FAD-dependent pyridine nucleotide-disulphide
FT                   oxidoreductase; KEGG: bxe:Bxe_B0747 pyridine
FT                   nucleotide-disulphide oxidoreductase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4427"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18803"
FT                   /db_xref="GOA:B2TFD2"
FT                   /db_xref="InterPro:IPR007419"
FT                   /db_xref="InterPro:IPR017224"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="InterPro:IPR041854"
FT                   /db_xref="UniProtKB/TrEMBL:B2TFD2"
FT                   /protein_id="ACD18803.1"
FT                   /translation="MSDERRIVIVGAGPAGVRAAETLVAAGVKPIVIDENARWGGQIYR
FT                   QPPANGGFERSKKTLYGFEAHKAEALHSTMAALLPHLDYRPDTLAWACEAGRLDTLHAG
FT                   RELRVPFSHLIIASGATDRVLPVPGWTLPGVYTLGAAQVALKAQGCAIGRRVVLAGTGP
FT                   LLYLVAYQYVKAGAQVVAVLDTSPFSQQIAAAPKLARLPGTFAKGLYYVGWLKTHGVRI
FT                   ERDVTLVGIRGVDGVQALEWRASREGSPTETIACDAVGVSFGLKPETQLADLAGCRFRF
FT                   DATNRCWLPEVDPAGRSSVRGLYLAGDGAGIAGADAAELAGRRAALALLDDLGIAHPRG
FT                   AGMPDAASIERSLKRIAVFREGIETAFAPPANCASQWPDDMTVCRCEEIDAGTLRRCIR
FT                   GGEANEINRLKALTRVGMGRCQGRMCGEAALTLLAEETGKPLDAVGRLRSQPPVKPIPL
FT                   APEMYADDLAEIPAEARDE"
     MSDERRIVIV GAGPAGVRAA ETLVAAGVKP IVIDENARWG GQIYRQPPAN GGFERSKKTL        60
     YGFEAHKAEA LHSTMAALLP HLDYRPDTLA WACEAGRLDT LHAGRELRVP FSHLIIASGA       120
     TDRVLPVPGW TLPGVYTLGA AQVALKAQGC AIGRRVVLAG TGPLLYLVAY QYVKAGAQVV       180
     AVLDTSPFSQ QIAAAPKLAR LPGTFAKGLY YVGWLKTHGV RIERDVTLVG IRGVDGVQAL       240
     EWRASREGSP TETIACDAVG VSFGLKPETQ LADLAGCRFR FDATNRCWLP EVDPAGRSSV       300
     RGLYLAGDGA GIAGADAAEL AGRRAALALL DDLGIAHPRG AGMPDAASIE RSLKRIAVFR       360
     EGIETAFAPP ANCASQWPDD MTVCRCEEID AGTLRRCIRG GEANEINRLK ALTRVGMGRC       420
     QGRMCGEAAL TLLAEETGKP LDAVGRLRSQ PPVKPIPLAP EMYADDLAEI PAEARDE          477
//

If you have problems or comments...

PBIL Back to PBIL home page