(data stored in ACNUC7421 zone)

EMBL: CP001053.PE429

CP001053.PE429       Location/Qualifiers
FT   CDS             complement(491743..492129)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4428"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: bam:Bamb_5373 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4428"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18804"
FT                   /db_xref="GOA:B2TFD3"
FT                   /db_xref="InterPro:IPR036010"
FT                   /db_xref="InterPro:IPR042204"
FT                   /db_xref="UniProtKB/TrEMBL:B2TFD3"
FT                   /protein_id="ACD18804.1"
FT                   /translation="MSSSDHALMPSTLPSTQNAASQFIRLAETRREPLHFFIDGQEVAA
FT                   LQGDTLLTAVLMQQRRVRESEFSGAPRAGFCLIGACQDCWMRTEDGKRVRACSTPVTEG
FT                   MRVLTRIAAVVTSAGAADENGEAR"
     MSSSDHALMP STLPSTQNAA SQFIRLAETR REPLHFFIDG QEVAALQGDT LLTAVLMQQR        60
     RVRESEFSGA PRAGFCLIGA CQDCWMRTED GKRVRACSTP VTEGMRVLTR IAAVVTSAGA       120
     ADENGEAR                                                                128
//

If you have problems or comments...

PBIL Back to PBIL home page