(data stored in ACNUC7421 zone)

EMBL: CP001053.PE430

CP001053.PE430       Location/Qualifiers
FT   CDS             complement(492129..492923)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4429"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: bxe:Bxe_B0748 ABC
FT                   polyamine/opine/phosphonate uptake family transporter,
FT                   inner membrane subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4429"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18805"
FT                   /db_xref="GOA:B2TFD4"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:B2TFD4"
FT                   /protein_id="ACD18805.1"
FT                   /translation="MRKNGPIALIFHTLVIAFVLAPLVIVVLVAFTPDETLTLPTHGVS
FT                   LRWFRAILNYPDFIGAFFNSLKLAFASATLSLIVALPAALAIGRARFPGRSFLNGLLLS
FT                   PLVIPGLVLGIALLRFFALIGATGSFAWLVLAHMIIITPFVMRLVLASVSGLDRSIEHA
FT                   AHSLGADPWTTFRRITFPMILPGITGGWLLAFINSFDELTMSIFVTSPQTVTLPVRMYM
FT                   YATESIDPMMASVSALVIFITGGAMLLLDRVYGLNRILIGQH"
     MRKNGPIALI FHTLVIAFVL APLVIVVLVA FTPDETLTLP THGVSLRWFR AILNYPDFIG        60
     AFFNSLKLAF ASATLSLIVA LPAALAIGRA RFPGRSFLNG LLLSPLVIPG LVLGIALLRF       120
     FALIGATGSF AWLVLAHMII ITPFVMRLVL ASVSGLDRSI EHAAHSLGAD PWTTFRRITF       180
     PMILPGITGG WLLAFINSFD ELTMSIFVTS PQTVTLPVRM YMYATESIDP MMASVSALVI       240
     FITGGAMLLL DRVYGLNRIL IGQH                                              264
//

If you have problems or comments...

PBIL Back to PBIL home page