(data stored in ACNUC7421 zone)

EMBL: CP001053.PE431

CP001053.PE431       Location/Qualifiers
FT   CDS             complement(492963..493877)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4430"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: bxe:Bxe_B0749 ABC
FT                   polyamine/opine/phosphonate uptake family transporter,
FT                   inner membrane subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4430"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18806"
FT                   /db_xref="GOA:B2TFD5"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:B2TFD5"
FT                   /protein_id="ACD18806.1"
FT                   /translation="MASTLPAADNPDMKSGNVRRAPWHAFLPLWLMCAPAFLLFVALVL
FT                   VPLLMTLVLTFYRFDPASGPIAAFQFGNYAEVLSSSYYHTIFLRTFGIAFLVTLLCIVI
FT                   GTPEAYVLSRMRDPYRSMFLLVILAPLLVSVVVRAFGWSMLLNTNGLVNQAFGLVGLGP
FT                   YKLEYTTFAIVIALVHVMLPFMVIPVWTALQKLDPQTENAALSLMASPATTLRRIVLPQ
FT                   LTPGILSGSLMVFGLSASAFAIPGLLGGRRLKVAATAVYDEFLGSLNWPLGATIALLLL
FT                   VANLIVMLTYYRVLERKYTRSLG"
     MASTLPAADN PDMKSGNVRR APWHAFLPLW LMCAPAFLLF VALVLVPLLM TLVLTFYRFD        60
     PASGPIAAFQ FGNYAEVLSS SYYHTIFLRT FGIAFLVTLL CIVIGTPEAY VLSRMRDPYR       120
     SMFLLVILAP LLVSVVVRAF GWSMLLNTNG LVNQAFGLVG LGPYKLEYTT FAIVIALVHV       180
     MLPFMVIPVW TALQKLDPQT ENAALSLMAS PATTLRRIVL PQLTPGILSG SLMVFGLSAS       240
     AFAIPGLLGG RRLKVAATAV YDEFLGSLNW PLGATIALLL LVANLIVMLT YYRVLERKYT       300
     RSLG                                                                    304
//

If you have problems or comments...

PBIL Back to PBIL home page