(data stored in ACNUC7421 zone)

EMBL: CP001053.PE435

CP001053.PE435       Location/Qualifiers
FT   CDS             complement(497961..498986)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4434"
FT                   /product="oligopeptide/dipeptide ABC transporter, ATPase
FT                   subunit"
FT                   /note="KEGG: bxe:Bxe_B0753 ABC oligopeptide/dipeptide
FT                   transporter, ATPase subunit; TIGRFAM:
FT                   oligopeptide/dipeptide ABC transporter, ATPase subunit;
FT                   PFAM: ABC transporter related; Oligopeptide/dipeptide ABC
FT                   transporter domain protein; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4434"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18810"
FT                   /db_xref="GOA:B2TFE3"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR013563"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B2TFE3"
FT                   /protein_id="ACD18810.1"
FT                   /translation="MNTTSLANQDAATLLRVDNLKVQFGVPRGGFPWSGKATLRAVDGV
FT                   SFNVRRGETVGLVGESGCGKSTLARAIIGLAPVASGSVRWLGDETVLPGARRNTSRLRR
FT                   DVQMIFQDPLASLDPRMTIEQIVSEPLTTHGQDVARADVQRRVLTMLERVGLNAQHLRR
FT                   YPHEFSGGQCQRVGIARALIGEPQLVICDEPVSALDVSIQAQIVNLLRDLQRELSLSLL
FT                   FVAHDLAVVKAISHRVLVMYLGRVMEFGDKREVYGTPRHPYTRALLSAVPVPDPVVERA
FT                   RRHLLLRGEIASPLNPPSGCAFRTRCPDAIDACAREIPQPVTHGARATRVACIRVEDTV
FT                   R"
     MNTTSLANQD AATLLRVDNL KVQFGVPRGG FPWSGKATLR AVDGVSFNVR RGETVGLVGE        60
     SGCGKSTLAR AIIGLAPVAS GSVRWLGDET VLPGARRNTS RLRRDVQMIF QDPLASLDPR       120
     MTIEQIVSEP LTTHGQDVAR ADVQRRVLTM LERVGLNAQH LRRYPHEFSG GQCQRVGIAR       180
     ALIGEPQLVI CDEPVSALDV SIQAQIVNLL RDLQRELSLS LLFVAHDLAV VKAISHRVLV       240
     MYLGRVMEFG DKREVYGTPR HPYTRALLSA VPVPDPVVER ARRHLLLRGE IASPLNPPSG       300
     CAFRTRCPDA IDACAREIPQ PVTHGARATR VACIRVEDTV R                           341
//

If you have problems or comments...

PBIL Back to PBIL home page