(data stored in ACNUC7421 zone)

EMBL: CP001053.PE437

CP001053.PE437       Location/Qualifiers
FT   CDS             complement(499983..500897)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4436"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: bxe:Bxe_B0755 ABC
FT                   oligopeptide/dipeptide transporter, inner membrane subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4436"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18812"
FT                   /db_xref="GOA:B2TFD8"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR025966"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:B2TFD8"
FT                   /protein_id="ACD18812.1"
FT                   /translation="MPRSIQSTAAALDPLAAIARAPRSRGPLATAAWRFVRNRAAFAGF
FT                   VVLMLIVIACVAGPWLLPNNPIDSDWSAISLPPTLQNMHWFGTDELGRDLLARTLQGGR
FT                   VSLEVGLLGTLVSGLIGVAYGATAGYLGGRVDAVMMRIVDMMYAIPYMLIAILMMTMFG
FT                   RAFYLVVLTISAFSWLDMARVVRGQTLSLRSREFIDAARAIGVSSGSIIARHIVPNLFG
FT                   VVVVYASVTVPNIVLTESVLSFLGLGVQEPMTSWGVLIQDGAQKLESMPWLLLCPAVML
FT                   CVTLYCVNFVGDGLRDAFDPKDR"
     MPRSIQSTAA ALDPLAAIAR APRSRGPLAT AAWRFVRNRA AFAGFVVLML IVIACVAGPW        60
     LLPNNPIDSD WSAISLPPTL QNMHWFGTDE LGRDLLARTL QGGRVSLEVG LLGTLVSGLI       120
     GVAYGATAGY LGGRVDAVMM RIVDMMYAIP YMLIAILMMT MFGRAFYLVV LTISAFSWLD       180
     MARVVRGQTL SLRSREFIDA ARAIGVSSGS IIARHIVPNL FGVVVVYASV TVPNIVLTES       240
     VLSFLGLGVQ EPMTSWGVLI QDGAQKLESM PWLLLCPAVM LCVTLYCVNF VGDGLRDAFD       300
     PKDR                                                                    304
//

If you have problems or comments...

PBIL Back to PBIL home page