(data stored in ACNUC7421 zone)

EMBL: CP001053.PE438

CP001053.PE438       Location/Qualifiers
FT   CDS             complement(500901..501839)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4437"
FT                   /product="Nickel-transporting ATPase"
FT                   /EC_number="3.6.3.24"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: bxe:Bxe_B0756 ABC
FT                   oligopeptide/dipeptide transporter, inner membrane subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4437"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18813"
FT                   /db_xref="GOA:B2TFD9"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:B2TFD9"
FT                   /protein_id="ACD18813.1"
FT                   /translation="MLAYTLRRTLWAIPTILAVITACYLLLHLTPGGPFDTEKQLSAAV
FT                   LANLNAKYHLDEPLWLQYLHYLGSLLHGDLGPSFRYADWSVNDLVWKALPVSLGVGGVS
FT                   VPIALVIGVALGTVAAVRRDRFVDHFVMVLGNLGNVVPPFVLGPVLVWIFAILLKTSEG
FT                   HGWLPAGGWGEGEWRYRVLPIVLLTIINVAAIARVMRGSMIEVLSGNFIRTARAKGLPG
FT                   RTIVLRHAMKPALMPVVSLLGSICISSITAAVVTESVFALPGLGQLVVNGAINRDYTLV
FT                   LGLVVLTTAVAVLFNLLVDLAYAWLDPRIRY"
     MLAYTLRRTL WAIPTILAVI TACYLLLHLT PGGPFDTEKQ LSAAVLANLN AKYHLDEPLW        60
     LQYLHYLGSL LHGDLGPSFR YADWSVNDLV WKALPVSLGV GGVSVPIALV IGVALGTVAA       120
     VRRDRFVDHF VMVLGNLGNV VPPFVLGPVL VWIFAILLKT SEGHGWLPAG GWGEGEWRYR       180
     VLPIVLLTII NVAAIARVMR GSMIEVLSGN FIRTARAKGL PGRTIVLRHA MKPALMPVVS       240
     LLGSICISSI TAAVVTESVF ALPGLGQLVV NGAINRDYTL VLGLVVLTTA VAVLFNLLVD       300
     LAYAWLDPRI RY                                                           312
//

If you have problems or comments...

PBIL Back to PBIL home page