(data stored in ACNUC7421 zone)

EMBL: CP001053.PE439

CP001053.PE439       Location/Qualifiers
FT   CDS             complement(501857..503473)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4438"
FT                   /product="extracellular solute-binding protein family 5"
FT                   /note="PFAM: extracellular solute-binding protein family 5;
FT                   KEGG: bxe:Bxe_B0757 ABC oligopeptide/dipeptide transporter,
FT                   periplasmic ligand binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4438"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18814"
FT                   /db_xref="GOA:B2TFE0"
FT                   /db_xref="InterPro:IPR000914"
FT                   /db_xref="InterPro:IPR030678"
FT                   /db_xref="InterPro:IPR039424"
FT                   /db_xref="UniProtKB/TrEMBL:B2TFE0"
FT                   /protein_id="ACD18814.1"
FT                   /translation="MKTPFVYTTALAALVLTFAPSAFAVTVPPGVTLAASQEMTRQVPG
FT                   ETESLDPAHIESWTGNTIGLDLFEGLTRMDASGAIVPGVAESWSRSGPNTWVFKLRHDA
FT                   RWSNGQPVTASDFVYSWQRVLDPKTGSKYTVLVEFVKNAKAILAGKAPLSSLGVRAVDP
FT                   YTLEVTTEVPATFFPQLTAMATMTPVNRAVVTKFDGDWTRPGNFVGNGPYALTDWQPSN
FT                   RLVATKSPTYWNNGKVVITKVTYLPIENDETAMRMYQAGQFDYTYSIPSGVYSQVSKQF
FT                   GPELKTGLQIATYYYSLNNDDPAFKDKRVRQALAMVLDRDLLTKRLTADGEVPMYGLIA
FT                   KGTEGSGVFTPEWANWPMAKRVDYARNLLKTAGYSDAKPLTFTLTYNTNDLHKKVALFA
FT                   TSEWRTKLGVTAKLENVEYKVLLKQRHDGKVQASRDGWFVDYNDANSFFDLIRCNSVQN
FT                   DQHYCNPQVDKLIDEGNQQLDDAKRTALFTQAHDLAMNDYPVVSLFQYSADRLVKSYVG
FT                   GYKPTNYLDMRATQDMYLTKH"
     MKTPFVYTTA LAALVLTFAP SAFAVTVPPG VTLAASQEMT RQVPGETESL DPAHIESWTG        60
     NTIGLDLFEG LTRMDASGAI VPGVAESWSR SGPNTWVFKL RHDARWSNGQ PVTASDFVYS       120
     WQRVLDPKTG SKYTVLVEFV KNAKAILAGK APLSSLGVRA VDPYTLEVTT EVPATFFPQL       180
     TAMATMTPVN RAVVTKFDGD WTRPGNFVGN GPYALTDWQP SNRLVATKSP TYWNNGKVVI       240
     TKVTYLPIEN DETAMRMYQA GQFDYTYSIP SGVYSQVSKQ FGPELKTGLQ IATYYYSLNN       300
     DDPAFKDKRV RQALAMVLDR DLLTKRLTAD GEVPMYGLIA KGTEGSGVFT PEWANWPMAK       360
     RVDYARNLLK TAGYSDAKPL TFTLTYNTND LHKKVALFAT SEWRTKLGVT AKLENVEYKV       420
     LLKQRHDGKV QASRDGWFVD YNDANSFFDL IRCNSVQNDQ HYCNPQVDKL IDEGNQQLDD       480
     AKRTALFTQA HDLAMNDYPV VSLFQYSADR LVKSYVGGYK PTNYLDMRAT QDMYLTKH         538
//

If you have problems or comments...

PBIL Back to PBIL home page