(data stored in ACNUC7421 zone)

EMBL: CP001053.PE44

CP001053.PE44        Location/Qualifiers
FT   CDS             complement(48178..49041)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4033"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: bxe:Bxe_B0493 ABC
FT                   nitrate/sulfonate/bicarbonate family transporter, inner
FT                   membrane subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4033"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18419"
FT                   /db_xref="GOA:B2TE98"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:B2TE98"
FT                   /protein_id="ACD18419.1"
FT                   /translation="MSTTPQQMMPSGIDAASLAHVERVAQKRIRQRHALVISLRIVVLV
FT                   VVLGGWELSARLKWIDPFFFSMPSAIFDQIIDWFVNGTSQGPLLTQVWVTLEETGLGFI
FT                   IGSVAGVFCGIVLGRNKLLSDVFSLYIKIANSIPRVVLGSVFVIALGLGMASKVALAVV
FT                   MVFFVVFANAFQGVREADRFMIANAQILGASRRQVTTSVVIPSALSWILASLHVSFGFA
FT                   LVGAVVGEFLGSKQGIGLLISTAQGAFNASGVFAAMIVLAVVALAADYLLTAVEQRLLK
FT                   WRPTAV"
     MSTTPQQMMP SGIDAASLAH VERVAQKRIR QRHALVISLR IVVLVVVLGG WELSARLKWI        60
     DPFFFSMPSA IFDQIIDWFV NGTSQGPLLT QVWVTLEETG LGFIIGSVAG VFCGIVLGRN       120
     KLLSDVFSLY IKIANSIPRV VLGSVFVIAL GLGMASKVAL AVVMVFFVVF ANAFQGVREA       180
     DRFMIANAQI LGASRRQVTT SVVIPSALSW ILASLHVSFG FALVGAVVGE FLGSKQGIGL       240
     LISTAQGAFN ASGVFAAMIV LAVVALAADY LLTAVEQRLL KWRPTAV                     287
//

If you have problems or comments...

PBIL Back to PBIL home page