(data stored in ACNUC7421 zone)

EMBL: CP001053.PE440

CP001053.PE440       Location/Qualifiers
FT   CDS             complement(503655..504227)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4439"
FT                   /product="transcriptional regulator, XRE family"
FT                   /note="PFAM: helix-turn-helix domain protein; protein of
FT                   unknown function DUF861 cupin_3; Cupin 2 conserved barrel
FT                   domain protein; KEGG: bxe:Bxe_B0758 transcriptional
FT                   regulator, XRE family with cupin sensor domain"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4439"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18815"
FT                   /db_xref="GOA:B2TE23"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR013096"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/TrEMBL:B2TE23"
FT                   /protein_id="ACD18815.1"
FT                   /translation="MVTTIQKSNPALEIGSKIRALRQRLKRTLDDTATAAGISKPFLSQ
FT                   VERGLASPSITSLAGIAHALGVTVQYFVDTPSEERCVSRGDQLKFFGFADSANLFARLT
FT                   NLTGGRQLEAILVRMPPGQKRSEVTTHAGEEFVYVIDGEVSLTLEGKTFVLHAGDSAHY
FT                   ESTVPHSWVNTARIESVVVWVGTPRLF"
     MVTTIQKSNP ALEIGSKIRA LRQRLKRTLD DTATAAGISK PFLSQVERGL ASPSITSLAG        60
     IAHALGVTVQ YFVDTPSEER CVSRGDQLKF FGFADSANLF ARLTNLTGGR QLEAILVRMP       120
     PGQKRSEVTT HAGEEFVYVI DGEVSLTLEG KTFVLHAGDS AHYESTVPHS WVNTARIESV       180
     VVWVGTPRLF                                                              190
//

If you have problems or comments...

PBIL Back to PBIL home page