(data stored in ACNUC7421 zone)

EMBL: CP001053.PE442

CP001053.PE442       Location/Qualifiers
FT   CDS             506911..508383
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4441"
FT                   /product="transcriptional regulator, GntR family with
FT                   aminotransferase domain"
FT                   /note="PFAM: regulatory protein GntR HTH; aminotransferase
FT                   class I and II; KEGG: bxe:Bxe_B0760 transcriptional
FT                   regulator, GntR family"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4441"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18817"
FT                   /db_xref="GOA:B2TE25"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B2TE25"
FT                   /protein_id="ACD18817.1"
FT                   /translation="MEIHIAVEGHHDLSGQIYRQLRAGILEGRLAGGTRLPSTRELATQ
FT                   LGVSRKTTLDVFERLLSEGYLSARGGSGTFVADGLERLPVERSAHARAAESSRERARAK
FT                   AAARAQPLWDEMPESLPLPKPSVASPQDFVGGATDKTLFPFDIWRRCVNHALRAQARGP
FT                   GIYRDTAGEQELRLAISRYLAFNRAVSSNWEDVIVTQGAQHALDLLARISLRAGEVAAI
FT                   EDPAYLPAHACLKATGARVVPVPVDAEGLIVSKLPDKARLVYVTPSHQFPLGMPMSLER
FT                   RVELLEWAQKRGAVIIEDDYDCEYRFEGRPMEPLKSLDRAGLVAYVGTFSKTIFPELRV
FT                   GYVVPPASLYGPLIKARQIGDWHGCTLTQTALASFMLNGEFAKHLRRMHKTYAARRAML
FT                   LDHLHGGLAPWFEPIVPTAGIHMAARLKAPLTEEAVVSAAREASIGLYGLAPFYVRAKP
FT                   QPGLMFGYGNIAVEHIDAALTKLAGILPRLTQ"
     MEIHIAVEGH HDLSGQIYRQ LRAGILEGRL AGGTRLPSTR ELATQLGVSR KTTLDVFERL        60
     LSEGYLSARG GSGTFVADGL ERLPVERSAH ARAAESSRER ARAKAAARAQ PLWDEMPESL       120
     PLPKPSVASP QDFVGGATDK TLFPFDIWRR CVNHALRAQA RGPGIYRDTA GEQELRLAIS       180
     RYLAFNRAVS SNWEDVIVTQ GAQHALDLLA RISLRAGEVA AIEDPAYLPA HACLKATGAR       240
     VVPVPVDAEG LIVSKLPDKA RLVYVTPSHQ FPLGMPMSLE RRVELLEWAQ KRGAVIIEDD       300
     YDCEYRFEGR PMEPLKSLDR AGLVAYVGTF SKTIFPELRV GYVVPPASLY GPLIKARQIG       360
     DWHGCTLTQT ALASFMLNGE FAKHLRRMHK TYAARRAMLL DHLHGGLAPW FEPIVPTAGI       420
     HMAARLKAPL TEEAVVSAAR EASIGLYGLA PFYVRAKPQP GLMFGYGNIA VEHIDAALTK       480
     LAGILPRLTQ                                                              490
//

If you have problems or comments...

PBIL Back to PBIL home page