(data stored in ACNUC7421 zone)

EMBL: CP001053.PE443

CP001053.PE443       Location/Qualifiers
FT   CDS             508898..509350
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4442"
FT                   /product="histone family protein DNA-binding protein"
FT                   /note="PFAM: histone family protein DNA-binding protein;
FT                   KEGG: bxe:Bxe_B0762 Bph2"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4442"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18818"
FT                   /db_xref="GOA:B2TE26"
FT                   /db_xref="InterPro:IPR000119"
FT                   /db_xref="InterPro:IPR010992"
FT                   /db_xref="UniProtKB/TrEMBL:B2TE26"
FT                   /protein_id="ACD18818.1"
FT                   /translation="MPTSAKKVAKKAAAPVPAKKVAAKKVPAKKAVAAKKVAVKASSAP
FT                   APIKDTFTKASLAAHVAERAAVEPKTAKAVLAALEDTILGAVHKKGAGEFTLSGLLKIV
FT                   VQAVPAKKKRFGKDPFSGEERWFPAKPASVRIKARPLKKLKDAAAG"
     MPTSAKKVAK KAAAPVPAKK VAAKKVPAKK AVAAKKVAVK ASSAPAPIKD TFTKASLAAH        60
     VAERAAVEPK TAKAVLAALE DTILGAVHKK GAGEFTLSGL LKIVVQAVPA KKKRFGKDPF       120
     SGEERWFPAK PASVRIKARP LKKLKDAAAG                                        150
//

If you have problems or comments...

PBIL Back to PBIL home page