(data stored in ACNUC7421 zone)

EMBL: CP001053.PE444

CP001053.PE444       Location/Qualifiers
FT   CDS             509755..511164
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4443"
FT                   /product="protein of unknown function DUF404"
FT                   /note="PFAM: protein of unknown function DUF404; protein of
FT                   unknown function DUF407; KEGG: bxe:Bxe_B0763 hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4443"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18819"
FT                   /db_xref="InterPro:IPR016450"
FT                   /db_xref="InterPro:IPR025841"
FT                   /db_xref="UniProtKB/TrEMBL:B2TE27"
FT                   /protein_id="ACD18819.1"
FT                   /translation="MRCYDEMRHHDDAVRPHYARFERWLVKQGNEAIARKRAEADLLFR
FT                   RVGITFAVNGDLSGTERLIPFDLIPRIIPRGEWQTLEAGLRQRVQALNLFIHDVYHDRN
FT                   IVRAGIVPAEQVYTNAQYRPEMQGVNVPLGVYAHIAGVDVVRAGDEGEFYVLEDNLRVP
FT                   SGVSYMLENRKMMMRLFPELFVQNRIAPVAHYPDLLLDTLRSVAPEGVDDPVVVVLTPG
FT                   MYNSAYFEHTFLAQQMGVELVEGKDLFVDDNYVFMRTTQGPKRVDVIYRRVDDDFLDPL
FT                   AFRNDSALGVPGLLTAYRAGRVALANAMGTGIADDKSIYPYVPEMIEFYLGEKPILNNV
FT                   PTFQCRKPDDLAYTLAHLPELVVKEVHGAGGYGMLVGPASTKAEIESFRERLIARPAGY
FT                   IAQPTLALSACPTFVEAGIAPRHIDLRPFVLSGKTVTMVAGGLTRVALQEGSLVVNSSQ
FT                   GGGTKDTWMVD"
     MRCYDEMRHH DDAVRPHYAR FERWLVKQGN EAIARKRAEA DLLFRRVGIT FAVNGDLSGT        60
     ERLIPFDLIP RIIPRGEWQT LEAGLRQRVQ ALNLFIHDVY HDRNIVRAGI VPAEQVYTNA       120
     QYRPEMQGVN VPLGVYAHIA GVDVVRAGDE GEFYVLEDNL RVPSGVSYML ENRKMMMRLF       180
     PELFVQNRIA PVAHYPDLLL DTLRSVAPEG VDDPVVVVLT PGMYNSAYFE HTFLAQQMGV       240
     ELVEGKDLFV DDNYVFMRTT QGPKRVDVIY RRVDDDFLDP LAFRNDSALG VPGLLTAYRA       300
     GRVALANAMG TGIADDKSIY PYVPEMIEFY LGEKPILNNV PTFQCRKPDD LAYTLAHLPE       360
     LVVKEVHGAG GYGMLVGPAS TKAEIESFRE RLIARPAGYI AQPTLALSAC PTFVEAGIAP       420
     RHIDLRPFVL SGKTVTMVAG GLTRVALQEG SLVVNSSQGG GTKDTWMVD                   469
//

If you have problems or comments...

PBIL Back to PBIL home page