(data stored in ACNUC7421 zone)

EMBL: CP001053.PE446

CP001053.PE446       Location/Qualifiers
FT   CDS             512292..513092
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4445"
FT                   /product="transglutaminase domain protein"
FT                   /note="PFAM: transglutaminase domain protein;
FT                   transglutaminase domain protein; KEGG: bxe:Bxe_B0765
FT                   transglutaminase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4445"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18821"
FT                   /db_xref="InterPro:IPR002931"
FT                   /db_xref="InterPro:IPR013589"
FT                   /db_xref="InterPro:IPR038765"
FT                   /db_xref="UniProtKB/TrEMBL:B2TE29"
FT                   /protein_id="ACD18821.1"
FT                   /translation="MYLTIRHDTSYRYEATVHYSIQQLRLTPASGASQVVRRWAIDAPG
FT                   KLDATFDAYGNVLHTLVINKPHSEIRLHVAGEVDTIPLIDGHLPDAVGPIPLEHFTCST
FT                   RLTEADAAVRELAESVPSLSSSANLIALAEQIVQRVKYNTGITEVTSTAAEALALGNGV
FT                   CQDHAHLMLACCRARGIPARYVSGYIEPGEVTHGASHAWVDVWVDGKGWISIDVTHAAF
FT                   ASELYCRLAVARDYEAAAPVRGRRIGGLEEQLKVSVTVSGQQSQ"
     MYLTIRHDTS YRYEATVHYS IQQLRLTPAS GASQVVRRWA IDAPGKLDAT FDAYGNVLHT        60
     LVINKPHSEI RLHVAGEVDT IPLIDGHLPD AVGPIPLEHF TCSTRLTEAD AAVRELAESV       120
     PSLSSSANLI ALAEQIVQRV KYNTGITEVT STAAEALALG NGVCQDHAHL MLACCRARGI       180
     PARYVSGYIE PGEVTHGASH AWVDVWVDGK GWISIDVTHA AFASELYCRL AVARDYEAAA       240
     PVRGRRIGGL EEQLKVSVTV SGQQSQ                                            266
//

If you have problems or comments...

PBIL Back to PBIL home page