(data stored in ACNUC7421 zone)

EMBL: CP001053.PE447

CP001053.PE447       Location/Qualifiers
FT   CDS             513266..514138
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4446"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bxe:Bxe_B0766 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4446"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18822"
FT                   /db_xref="InterPro:IPR016545"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="UniProtKB/TrEMBL:B2TE30"
FT                   /protein_id="ACD18822.1"
FT                   /translation="MTYCVAMSVDDGLVFLSDTRTNAGVDHISTARKMSVFEQPGERML
FT                   TLLGAGNLSLTQAVLHELSEPTDPSLPTLWNAPTMADAARVIGRAVRCVHQREAEALQE
FT                   FGVDFNCSFILGGQIAGNRPRLFMIYAAGNFIEASAVNPYFQIGEAKYGKPIIDRVLTP
FT                   STPLDEAAKCALISMDSTLRSNLSVGLPLDLLVYQKDTLHVTRFVSIDHDNAYFEMIHR
FT                   TWGERLRQVFGEIPDPDWQESPNVPLLQRERALVLHRAPVGADGIEHELDAKPAQTLAQ
FT                   AERGKAQRK"
     MTYCVAMSVD DGLVFLSDTR TNAGVDHIST ARKMSVFEQP GERMLTLLGA GNLSLTQAVL        60
     HELSEPTDPS LPTLWNAPTM ADAARVIGRA VRCVHQREAE ALQEFGVDFN CSFILGGQIA       120
     GNRPRLFMIY AAGNFIEASA VNPYFQIGEA KYGKPIIDRV LTPSTPLDEA AKCALISMDS       180
     TLRSNLSVGL PLDLLVYQKD TLHVTRFVSI DHDNAYFEMI HRTWGERLRQ VFGEIPDPDW       240
     QESPNVPLLQ RERALVLHRA PVGADGIEHE LDAKPAQTLA QAERGKAQRK                  290
//

If you have problems or comments...

PBIL Back to PBIL home page