(data stored in ACNUC7421 zone)

EMBL: CP001053.PE450

CP001053.PE450       Location/Qualifiers
FT   CDS             517568..518107
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4449"
FT                   /product="YbaK/prolyl-tRNA synthetase associated region"
FT                   /note="PFAM: YbaK/prolyl-tRNA synthetase associated region;
FT                   KEGG: bxe:Bxe_B0770 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4449"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18825"
FT                   /db_xref="GOA:B2TE33"
FT                   /db_xref="InterPro:IPR007214"
FT                   /db_xref="InterPro:IPR036754"
FT                   /db_xref="UniProtKB/TrEMBL:B2TE33"
FT                   /protein_id="ACD18825.1"
FT                   /translation="MHSHELVQRLDVIAAEQLGAHLPAHVVEQLPAQGVTVFSVTDDAS
FT                   DTAAFSERYGFGLEDCANTIVIRYKKEGAEHYAAVVSLGSLRLDINGAVKAALGAQRLS
FT                   FAKREAAVEHSGMEFGGITAFGLPDDWRILVDAAVMERTQIVMGAGVRAAKLLLSPDVL
FT                   RQWPRCEVAALTLPAE"
     MHSHELVQRL DVIAAEQLGA HLPAHVVEQL PAQGVTVFSV TDDASDTAAF SERYGFGLED        60
     CANTIVIRYK KEGAEHYAAV VSLGSLRLDI NGAVKAALGA QRLSFAKREA AVEHSGMEFG       120
     GITAFGLPDD WRILVDAAVM ERTQIVMGAG VRAAKLLLSP DVLRQWPRCE VAALTLPAE        179
//

If you have problems or comments...

PBIL Back to PBIL home page