(data stored in ACNUC7421 zone)

EMBL: CP001053.PE451

CP001053.PE451       Location/Qualifiers
FT   CDS             518424..519983
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4450"
FT                   /product="methyl-accepting chemotaxis sensory transducer"
FT                   /note="PFAM: chemotaxis sensory transducer; Cache type 2
FT                   domain protein; KEGG: bxe:Bxe_B0771 methyl-accepting
FT                   chemotaxis sensory transducer"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4450"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18826"
FT                   /db_xref="GOA:B2TE34"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="InterPro:IPR004090"
FT                   /db_xref="InterPro:IPR033480"
FT                   /db_xref="UniProtKB/TrEMBL:B2TE34"
FT                   /protein_id="ACD18826.1"
FT                   /translation="MERFRLKVRLWLALAVMCMGILAIGLWGAFKTRDTMIADRQAELK
FT                   SVVSVAYSVLDRYNGLVAAGSMPLADAQRTAMADLRAMRYDGAGGYLVIEDAHARVLMH
FT                   GVRADLEGKDMSGFTDPQGRHVFKDGSDLAQREGEGFIHLQFLKPGSNEMAPKINYVRL
FT                   YKPWDWTIVTGVFTDDIDAAFYTTLVQYVGAALLLCLVVSLVIGVILRSILRQLGGEPA
FT                   YAAQIAARIADGELDVIVDTKAGDDTSLLAAMQRMQQRLAHAITQIRGGATLISTVSNE
FT                   IAAGNADLSRRTEQQATALGETASSMEQITATVKQNADNAKQASQLAHNASETAARGGE
FT                   VVDQVVETMRGISQSSHRIGDIIGVIEGIAFQTNILALNAAVEAARAGEEGRGFAVVAG
FT                   EVRSLAQRSAAAAKEIKTLIEESAAQIEGGSQYVSRAGETMHEVVQAVRRVTDIMGEIS
FT                   AASVEQSSGIEQVNIAVASMDQTTQQNAALVEEASASADVLKAQTGQLSAAIAVFTLPE
FT                   TR"
     MERFRLKVRL WLALAVMCMG ILAIGLWGAF KTRDTMIADR QAELKSVVSV AYSVLDRYNG        60
     LVAAGSMPLA DAQRTAMADL RAMRYDGAGG YLVIEDAHAR VLMHGVRADL EGKDMSGFTD       120
     PQGRHVFKDG SDLAQREGEG FIHLQFLKPG SNEMAPKINY VRLYKPWDWT IVTGVFTDDI       180
     DAAFYTTLVQ YVGAALLLCL VVSLVIGVIL RSILRQLGGE PAYAAQIAAR IADGELDVIV       240
     DTKAGDDTSL LAAMQRMQQR LAHAITQIRG GATLISTVSN EIAAGNADLS RRTEQQATAL       300
     GETASSMEQI TATVKQNADN AKQASQLAHN ASETAARGGE VVDQVVETMR GISQSSHRIG       360
     DIIGVIEGIA FQTNILALNA AVEAARAGEE GRGFAVVAGE VRSLAQRSAA AAKEIKTLIE       420
     ESAAQIEGGS QYVSRAGETM HEVVQAVRRV TDIMGEISAA SVEQSSGIEQ VNIAVASMDQ       480
     TTQQNAALVE EASASADVLK AQTGQLSAAI AVFTLPETR                              519
//

If you have problems or comments...

PBIL Back to PBIL home page