(data stored in ACNUC7421 zone)

EMBL: CP001053.PE452

CP001053.PE452       Location/Qualifiers
FT   CDS             complement(520014..520460)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4451"
FT                   /product="response regulator receiver protein"
FT                   /note="KEGG: bxe:Bxe_C0361 response regulator receiver
FT                   domain protein(CheY)"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4451"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18827"
FT                   /db_xref="GOA:B2TE35"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="UniProtKB/TrEMBL:B2TE35"
FT                   /protein_id="ACD18827.1"
FT                   /translation="MTRRVSLDDETEFAIWKRRSTADSGPSHRILIGHRDKAIGESLVL
FT                   SLSLKGYEAIYAADLIKVQSFLKWWKPHAVLLDTRLDSVSSYEFARAARAERSNADVLI
FT                   LAMSNVWPLDPVSLLKDAGFDGHCRRPCSLWRVADILEHHFARQ"
     MTRRVSLDDE TEFAIWKRRS TADSGPSHRI LIGHRDKAIG ESLVLSLSLK GYEAIYAADL        60
     IKVQSFLKWW KPHAVLLDTR LDSVSSYEFA RAARAERSNA DVLILAMSNV WPLDPVSLLK       120
     DAGFDGHCRR PCSLWRVADI LEHHFARQ                                          148
//

If you have problems or comments...

PBIL Back to PBIL home page