(data stored in ACNUC7421 zone)

EMBL: CP001053.PE455

CP001053.PE455       Location/Qualifiers
FT   CDS             complement(523184..524572)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4454"
FT                   /product="FAD linked oxidase domain protein"
FT                   /note="PFAM: FAD linked oxidase domain protein;
FT                   Berberine/berberine domain protein; KEGG: bxe:Bxe_B0773
FT                   putative FAD/FMN-containing oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4454"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18830"
FT                   /db_xref="GOA:B2TE38"
FT                   /db_xref="InterPro:IPR006093"
FT                   /db_xref="InterPro:IPR006094"
FT                   /db_xref="InterPro:IPR012951"
FT                   /db_xref="InterPro:IPR016166"
FT                   /db_xref="InterPro:IPR016167"
FT                   /db_xref="InterPro:IPR016169"
FT                   /db_xref="InterPro:IPR036318"
FT                   /db_xref="UniProtKB/TrEMBL:B2TE38"
FT                   /protein_id="ACD18830.1"
FT                   /translation="MVNVSSSAVDELKTAMRGQVLLPGDAAFDEARSIWNAMIDRHPAI
FT                   ILRCAGVADIRQGVAFARDNGLPLAIRGGGHNIGGSALCNDGVVLDLSQMKSVQIDPTA
FT                   RRAYVEPGATLHDFDHEAQAFGLATPLGINSTTGVAGLTLGGGFGWLSRRYGMTVDNLV
FT                   SADVVTAEGELVHASADSHEDLFWAIRGGGGNFGVVTRFEFALHPVGPLVYGGLVVLPI
FT                   EQARDALLKYRAANATMPKELSVWAVLRLAPPLPFLPPEVHGKPVIVFAMCYTGAVESG
FT                   PSTVEFVRAFGTPLGEHLGPMPYVMWQQAFDPLLTPGARNYWKSHNLVDIPDGLIDALL
FT                   RSIDNLPSPQCEIFFGQIGKQTQSVPVEATAYSSRNTVYAMNVHGRWDDASDDARCVGW
FT                   ARAFFDAAAPFALGSVYVNFMTEEEGGRVADAYGPNYERLVAVKNRYDPRNLFRHNQNI
FT                   RPSA"
     MVNVSSSAVD ELKTAMRGQV LLPGDAAFDE ARSIWNAMID RHPAIILRCA GVADIRQGVA        60
     FARDNGLPLA IRGGGHNIGG SALCNDGVVL DLSQMKSVQI DPTARRAYVE PGATLHDFDH       120
     EAQAFGLATP LGINSTTGVA GLTLGGGFGW LSRRYGMTVD NLVSADVVTA EGELVHASAD       180
     SHEDLFWAIR GGGGNFGVVT RFEFALHPVG PLVYGGLVVL PIEQARDALL KYRAANATMP       240
     KELSVWAVLR LAPPLPFLPP EVHGKPVIVF AMCYTGAVES GPSTVEFVRA FGTPLGEHLG       300
     PMPYVMWQQA FDPLLTPGAR NYWKSHNLVD IPDGLIDALL RSIDNLPSPQ CEIFFGQIGK       360
     QTQSVPVEAT AYSSRNTVYA MNVHGRWDDA SDDARCVGWA RAFFDAAAPF ALGSVYVNFM       420
     TEEEGGRVAD AYGPNYERLV AVKNRYDPRN LFRHNQNIRP SA                          462
//

If you have problems or comments...

PBIL Back to PBIL home page