(data stored in ACNUC7421 zone)

EMBL: CP001053.PE457

CP001053.PE457       Location/Qualifiers
FT   CDS             525714..525911
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4456"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4456"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18832"
FT                   /db_xref="UniProtKB/TrEMBL:B2TE40"
FT                   /protein_id="ACD18832.1"
FT                   /translation="MLVLSPETEFAPGPCDGAYSANEFRKGVAADPMTECFYSLDGFVR
FT                   CSGWQVIMAQVNSPGVAPSV"
     MLVLSPETEF APGPCDGAYS ANEFRKGVAA DPMTECFYSL DGFVRCSGWQ VIMAQVNSPG        60
     VAPSV                                                                    65
//

If you have problems or comments...

PBIL Back to PBIL home page