(data stored in ACNUC7421 zone)

EMBL: CP001053.PE461

CP001053.PE461       Location/Qualifiers
FT   CDS             complement(529610..532255)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4460"
FT                   /product="DEAD/H associated domain protein"
FT                   /note="PFAM: helicase domain protein; DEAD/DEAH box
FT                   helicase domain protein; DEAD/H associated domain protein;
FT                   SMART: DEAD-like helicases; KEGG: bxe:Bxe_B0778 putative
FT                   DEAD/DEAH box helicase"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4460"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18836"
FT                   /db_xref="GOA:B2TE44"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR013701"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR017170"
FT                   /db_xref="InterPro:IPR026362"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B2TE44"
FT                   /protein_id="ACD18836.1"
FT                   /translation="MTEPADSDETTIPAPSAASERRRAPRPRRIPRSREQQARLDAREP
FT                   AFEPQPFSIDENAAQRPFAEKLGEWFEARRWQPFEFQREVWQEIARGASGLLHATTGAG
FT                   KTWAVWFGALAAFAATPSARKRSTLRTQPEPLTVLWITPMRALAADTARALQSSAAELA
FT                   VPWSVGLRTGDTSSAERARQNRRMPSALVTTPESLSLILTRPDAHDVLAHVRLVIVDEW
FT                   HELLGNKRGTQTQLALARLAHWRPELQVWGLSATLGNLSFAGDVLLAPVKTPRVSVHGA
FT                   LPKALIVDTVIPETIERFPWGGHVGMRQVGAVAEAIGEAQTSLVFTNTRSQCEVWYQAL
FT                   LEARPEWAGLIALHHGSLDQEVREWVERGLKSGLLKVVVCTSSLDLGVDFLPVERVFQI
FT                   GSPKGVARLMQRAGRSGHAPGRPSRVTIVPTHALELVEAAAAREAVEKRQIEGRETPEK
FT                   PFDVLVQHLVTVAIGGGFDARELYGEIRSTYAYRQLTQAEFDWALGFVEGGGTALRAYP
FT                   DYHRVVRESDGMYHVPREDLVRRHRNNIGTIVANGTLNVAYLSGGRIGAIEESFISRLK
FT                   PGDIFTFGGRALELIRVQDMTAWVRRATSSRGAMPQWAGSRMPLSSELADATLTMLARA
FT                   ATGIYDEPEMRAVRPLLELQQKWSALPEPGVLVVELVKSREGHHFFCYPFAGRTAHIGL
FT                   GALLAWRVAREKPGTFSISMNDYGFELLSAQPFDWAAQLESGLLSPKELDHDILASLNS
FT                   SELSLRRFREIARVSGLVFQGHPGQQKSARQLQASSALFYEIFRNHDRGNLLLNQADDE
FT                   VLLQELDARRIRIALERMNASRVVVTRPKKPTPFAFPLIVGRLREKVSTEKLADRVERM
FT                   LAELEKAARV"
     MTEPADSDET TIPAPSAASE RRRAPRPRRI PRSREQQARL DAREPAFEPQ PFSIDENAAQ        60
     RPFAEKLGEW FEARRWQPFE FQREVWQEIA RGASGLLHAT TGAGKTWAVW FGALAAFAAT       120
     PSARKRSTLR TQPEPLTVLW ITPMRALAAD TARALQSSAA ELAVPWSVGL RTGDTSSAER       180
     ARQNRRMPSA LVTTPESLSL ILTRPDAHDV LAHVRLVIVD EWHELLGNKR GTQTQLALAR       240
     LAHWRPELQV WGLSATLGNL SFAGDVLLAP VKTPRVSVHG ALPKALIVDT VIPETIERFP       300
     WGGHVGMRQV GAVAEAIGEA QTSLVFTNTR SQCEVWYQAL LEARPEWAGL IALHHGSLDQ       360
     EVREWVERGL KSGLLKVVVC TSSLDLGVDF LPVERVFQIG SPKGVARLMQ RAGRSGHAPG       420
     RPSRVTIVPT HALELVEAAA AREAVEKRQI EGRETPEKPF DVLVQHLVTV AIGGGFDARE       480
     LYGEIRSTYA YRQLTQAEFD WALGFVEGGG TALRAYPDYH RVVRESDGMY HVPREDLVRR       540
     HRNNIGTIVA NGTLNVAYLS GGRIGAIEES FISRLKPGDI FTFGGRALEL IRVQDMTAWV       600
     RRATSSRGAM PQWAGSRMPL SSELADATLT MLARAATGIY DEPEMRAVRP LLELQQKWSA       660
     LPEPGVLVVE LVKSREGHHF FCYPFAGRTA HIGLGALLAW RVAREKPGTF SISMNDYGFE       720
     LLSAQPFDWA AQLESGLLSP KELDHDILAS LNSSELSLRR FREIARVSGL VFQGHPGQQK       780
     SARQLQASSA LFYEIFRNHD RGNLLLNQAD DEVLLQELDA RRIRIALERM NASRVVVTRP       840
     KKPTPFAFPL IVGRLREKVS TEKLADRVER MLAELEKAAR V                           881
//

If you have problems or comments...

PBIL Back to PBIL home page