(data stored in ACNUC7421 zone)

EMBL: CP001053.PE463

CP001053.PE463       Location/Qualifiers
FT   CDS             533398..533748
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4462"
FT                   /product="peptidylprolyl isomerase FKBP-type"
FT                   /note="PFAM: peptidylprolyl isomerase FKBP-type; KEGG:
FT                   bxe:Bxe_B0780 putative FKBP-type peptidyl-prolyl
FT                   cis-transisomerase signal peptide protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4462"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18838"
FT                   /db_xref="GOA:B2TE49"
FT                   /db_xref="InterPro:IPR001179"
FT                   /db_xref="UniProtKB/TrEMBL:B2TE49"
FT                   /protein_id="ACD18838.1"
FT                   /translation="MAAAPTTEKLPSGVVVEHLTQGTGAQPAAEDVVKVNYRGTLANGT
FT                   EFDSSAKHGGPATFPLNRVIPCWTQGVQKMKVGGKAKLTCPAATAYGDRGVGVIPPNSD
FT                   LTFEVELVGIVK"
     MAAAPTTEKL PSGVVVEHLT QGTGAQPAAE DVVKVNYRGT LANGTEFDSS AKHGGPATFP        60
     LNRVIPCWTQ GVQKMKVGGK AKLTCPAATA YGDRGVGVIP PNSDLTFEVE LVGIVK           116
//

If you have problems or comments...

PBIL Back to PBIL home page