(data stored in ACNUC7421 zone)

EMBL: CP001053.PE464

CP001053.PE464       Location/Qualifiers
FT   CDS             533849..534310
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4463"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bxe:Bxe_B0781 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4463"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18839"
FT                   /db_xref="InterPro:IPR007438"
FT                   /db_xref="UniProtKB/TrEMBL:B2TE50"
FT                   /protein_id="ACD18839.1"
FT                   /translation="MKRENNAVPVASIGFTGKTAEEFFDLLKNAQVRTVLDIRLSNTSQ
FT                   LAGFAKKQDLPFFLDKLCGAVYREMPELAPEPDLFKRYKANELTWDEFSAAYVELIARR
FT                   RVESNLDVDLFRSACLLCSEHLPHHCHRRLALEYLNSRWNSRLKITHLS"
     MKRENNAVPV ASIGFTGKTA EEFFDLLKNA QVRTVLDIRL SNTSQLAGFA KKQDLPFFLD        60
     KLCGAVYREM PELAPEPDLF KRYKANELTW DEFSAAYVEL IARRRVESNL DVDLFRSACL       120
     LCSEHLPHHC HRRLALEYLN SRWNSRLKIT HLS                                    153
//

If you have problems or comments...

PBIL Back to PBIL home page