(data stored in ACNUC7421 zone)

EMBL: CP001053.PE472

CP001053.PE472       Location/Qualifiers
FT   CDS             complement(540002..540955)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4471"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bch:Bcen2424_3546 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4471"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18847"
FT                   /db_xref="UniProtKB/TrEMBL:B2T7U5"
FT                   /protein_id="ACD18847.1"
FT                   /translation="MNAFSFACTACGKCCNSPPAMALPELFRHRDRFIGCLAIGRVPRR
FT                   RVGERLRVGRHEAVLDEADIAAFDSIANTLLYRTGDTFSIMTQGYDYPSLARCPALADD
FT                   GRCAIHLNGKPVTCEVVPLDPFVPDALQHLVLAGRNQSASYIGADCIQEGERADAPLLT
FT                   AEGEIKDANARDALARRRSALEREREVWGRAVFDSLRKDLFASPAALARIPPGGFLTIS
FT                   IVPVLLAVASTSARCRQLCLDYIDSQIALIGRNIEQALLRRRLEDRAVTQELRGFAHAY
FT                   QRAKALLGTTLPAMEVESSAPSSLSSIEAYLCGAHR"
     MNAFSFACTA CGKCCNSPPA MALPELFRHR DRFIGCLAIG RVPRRRVGER LRVGRHEAVL        60
     DEADIAAFDS IANTLLYRTG DTFSIMTQGY DYPSLARCPA LADDGRCAIH LNGKPVTCEV       120
     VPLDPFVPDA LQHLVLAGRN QSASYIGADC IQEGERADAP LLTAEGEIKD ANARDALARR       180
     RSALEREREV WGRAVFDSLR KDLFASPAAL ARIPPGGFLT ISIVPVLLAV ASTSARCRQL       240
     CLDYIDSQIA LIGRNIEQAL LRRRLEDRAV TQELRGFAHA YQRAKALLGT TLPAMEVESS       300
     APSSLSSIEA YLCGAHR                                                      317
//

If you have problems or comments...

PBIL Back to PBIL home page