(data stored in ACNUC7421 zone)

EMBL: CP001053.PE474

CP001053.PE474       Location/Qualifiers
FT   CDS             complement(541743..542828)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4473"
FT                   /product="protein of unknown function DUF323"
FT                   /note="PFAM: protein of unknown function DUF323; KEGG:
FT                   bmu:Bmul_5129 protein of unknown function DUF323"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4473"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18849"
FT                   /db_xref="GOA:B2T7U7"
FT                   /db_xref="InterPro:IPR005532"
FT                   /db_xref="InterPro:IPR016187"
FT                   /db_xref="InterPro:IPR042095"
FT                   /db_xref="UniProtKB/TrEMBL:B2T7U7"
FT                   /protein_id="ACD18849.1"
FT                   /translation="MTVRSKLKSNTALYGVYAAIATVAFATAFTAATAASAVFSGGAKQ
FT                   RAFDELNTSRPLAALGSEQQCARYAGLPARWRDDPKAGMVHLHGGDFVFGSKLGYEDER
FT                   PAGDGKTRVAGFWIDQTDVTNAQFAAFVKATGYVSDSERQGGAVVFHTPTRDEMNARDL
FT                   AWWTWVKGAAWNHPTGPGSTLEGRLNQPVTMVTQADALAYARWLGRDLPTEAEWEYAGK
FT                   AGREGADLDTAPRDGHGKPSANYWQGVFPVLNTNEDGHIGLAPVGCYAANDFKLYDMIG
FT                   NAWEWTKDVYTGPHQSHTNGDTAEVAPLSRKHDTPMVIKGGSFLCSRDYCVRYRAASRE
FT                   QQEADLPASHIGFRTVLRDAS"
     MTVRSKLKSN TALYGVYAAI ATVAFATAFT AATAASAVFS GGAKQRAFDE LNTSRPLAAL        60
     GSEQQCARYA GLPARWRDDP KAGMVHLHGG DFVFGSKLGY EDERPAGDGK TRVAGFWIDQ       120
     TDVTNAQFAA FVKATGYVSD SERQGGAVVF HTPTRDEMNA RDLAWWTWVK GAAWNHPTGP       180
     GSTLEGRLNQ PVTMVTQADA LAYARWLGRD LPTEAEWEYA GKAGREGADL DTAPRDGHGK       240
     PSANYWQGVF PVLNTNEDGH IGLAPVGCYA ANDFKLYDMI GNAWEWTKDV YTGPHQSHTN       300
     GDTAEVAPLS RKHDTPMVIK GGSFLCSRDY CVRYRAASRE QQEADLPASH IGFRTVLRDA       360
     S                                                                       361
//

If you have problems or comments...

PBIL Back to PBIL home page