(data stored in ACNUC7421 zone)

EMBL: CP001053.PE478

CP001053.PE478       Location/Qualifiers
FT   CDS             complement(546243..547658)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4477"
FT                   /product="integral membrane sensor signal transduction
FT                   histidine kinase"
FT                   /note="PFAM: ATP-binding region ATPase domain protein;
FT                   histidine kinase dimerisation and phosphoacceptor region;
FT                   Cache type 2 domain protein; KEGG: bxe:Bxe_B0789
FT                   periplasmic sensor signal transduction histidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4477"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18853"
FT                   /db_xref="GOA:B2T7V1"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR011712"
FT                   /db_xref="InterPro:IPR017171"
FT                   /db_xref="InterPro:IPR033480"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:B2T7V1"
FT                   /protein_id="ACD18853.1"
FT                   /translation="MKLKAKIVLLAIVPFLAAIASIEVGVQRQATALAETQHASTQAAY
FT                   MASKEIELKHYVELATTAIAPLYDAGQDNARDDATLRARALDVLQKMDFGKDGYFFVYD
FT                   MHGRSLMHPREPDLVGRDLWELRDPQGTLTIQQLLAAAARGGGYVRYLWHRPSTGKVAS
FT                   KLGYVVPLERWGWMIGTGIYLDDVDNTLAHIDERAAANIDRTMKWIDAIAVAGLAVIAL
FT                   CALVLNVTEYRSADAKLKRLAQQVVESQENERARLSRELHDGISQMMVSVKLLLESALA
FT                   RFERSEVRVPAAEAALTTSLTRLGDTLREVRRISHALRPSMLDDLGVAAALEQLSRELS
FT                   EQSGIEIGFTQIAHTHAAALPDAVNTVLFRIAQEALTNIVRHAQATNAALALEISNDGV
FT                   TLNIADNGRGFDVAHAFVGRRSGVGLRNMRERLEALGGTLSLSSQAGHTLVTARVPLGS
FT                   TEPTLPALQETSP"
     MKLKAKIVLL AIVPFLAAIA SIEVGVQRQA TALAETQHAS TQAAYMASKE IELKHYVELA        60
     TTAIAPLYDA GQDNARDDAT LRARALDVLQ KMDFGKDGYF FVYDMHGRSL MHPREPDLVG       120
     RDLWELRDPQ GTLTIQQLLA AAARGGGYVR YLWHRPSTGK VASKLGYVVP LERWGWMIGT       180
     GIYLDDVDNT LAHIDERAAA NIDRTMKWID AIAVAGLAVI ALCALVLNVT EYRSADAKLK       240
     RLAQQVVESQ ENERARLSRE LHDGISQMMV SVKLLLESAL ARFERSEVRV PAAEAALTTS       300
     LTRLGDTLRE VRRISHALRP SMLDDLGVAA ALEQLSRELS EQSGIEIGFT QIAHTHAAAL       360
     PDAVNTVLFR IAQEALTNIV RHAQATNAAL ALEISNDGVT LNIADNGRGF DVAHAFVGRR       420
     SGVGLRNMRE RLEALGGTLS LSSQAGHTLV TARVPLGSTE PTLPALQETS P                471
//

If you have problems or comments...

PBIL Back to PBIL home page