(data stored in ACNUC7421 zone)

EMBL: CP001053.PE48

CP001053.PE48        Location/Qualifiers
FT   CDS             51829..53223
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4037"
FT                   /product="histidine kinase"
FT                   /note="PFAM: ATP-binding region ATPase domain protein;
FT                   histidine kinase A domain protein; Two-component sensor
FT                   kinase domain protein; KEGG: bxe:Bxe_B0497 histidine
FT                   kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4037"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18423"
FT                   /db_xref="GOA:B2TEA2"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR013727"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:B2TEA2"
FT                   /protein_id="ACD18423.1"
FT                   /translation="MTNSLRMRLLWWLLVPLALYVFVTGKAEYDNARRTADLVQDNQLI
FT                   SSARMIAGEVEWVDGFLRVDVPPAALEVFVSPYRDQVFYSVQVDDGRLLAGIPDFPARP
FT                   VQTPDTPDHYDTRLQGHDVRAVGLVRLMYDNGATRRVRVTVGKTVRSRDAMAQQLWQPQ
FT                   LVRQIEMIVLAVALVCIGLTFELRPLMKVKEEVADRDPMQLEPIRVERLHTELRPIVEA
FT                   INQCIARLGVQVAAQRRFIADAAHQLRTPLTLLGTQLQFARQQDGLNPALDEALAAMHR
FT                   SNRSMVGLTNKLLLLAQAEAADNKQLAVETVDLVPLALEVVEDLALLAQARDIDLGAEL
FT                   NGAAPVAGHRGLLQALIANLAENAIRYTGSGGHVTVGVSADADTVTVSVLDDGPGIPAE
FT                   SRGRVFEPFFRASADTEGTGLGLAIVREIADAHHGEIALKPGDGGKGVHISVVFPRAAA
FT                   ERFKAG"
     MTNSLRMRLL WWLLVPLALY VFVTGKAEYD NARRTADLVQ DNQLISSARM IAGEVEWVDG        60
     FLRVDVPPAA LEVFVSPYRD QVFYSVQVDD GRLLAGIPDF PARPVQTPDT PDHYDTRLQG       120
     HDVRAVGLVR LMYDNGATRR VRVTVGKTVR SRDAMAQQLW QPQLVRQIEM IVLAVALVCI       180
     GLTFELRPLM KVKEEVADRD PMQLEPIRVE RLHTELRPIV EAINQCIARL GVQVAAQRRF       240
     IADAAHQLRT PLTLLGTQLQ FARQQDGLNP ALDEALAAMH RSNRSMVGLT NKLLLLAQAE       300
     AADNKQLAVE TVDLVPLALE VVEDLALLAQ ARDIDLGAEL NGAAPVAGHR GLLQALIANL       360
     AENAIRYTGS GGHVTVGVSA DADTVTVSVL DDGPGIPAES RGRVFEPFFR ASADTEGTGL       420
     GLAIVREIAD AHHGEIALKP GDGGKGVHIS VVFPRAAAER FKAG                        464
//

If you have problems or comments...

PBIL Back to PBIL home page