(data stored in ACNUC7421 zone)

EMBL: CP001053.PE483

CP001053.PE483       Location/Qualifiers
FT   CDS             552517..555135
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4484"
FT                   /product="protein of unknown function DUF802"
FT                   /note="PFAM: protein of unknown function DUF802; KEGG:
FT                   bpm:BURPS1710b_A0266 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4484"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18858"
FT                   /db_xref="GOA:B2T7V6"
FT                   /db_xref="InterPro:IPR008520"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="UniProtKB/TrEMBL:B2T7V6"
FT                   /protein_id="ACD18858.1"
FT                   /translation="MSRYRIDLVVFLAGLAAVCWIAAGYLGSNPLALAVTLLIGVCYLA
FT                   GSLELHRYNQATATLTQAVAGLSGPPPSLGTWLEPLHPSLRHAARLRVEGERVALPGPA
FT                   LTPYLVGLLVLLGMLGTLLGMVVTLRGTGMALESATDLQAIRASLAAPVKGLGFAFGTS
FT                   IAGVATSAMLGLLSALCRRERLQAAQMLDVKIATILRIYSQSHQREEAFRLLQRQSEVM
FT                   PTLVDRLQTMMSAIEQQSLALNERQIASQEAFHGRAEAAYTRLASSVEQSLKESVADST
FT                   RAAGAALQPVMQATMAGLARETAVLHDTVTHAVQRQLDGLSSGFETTTTTVADIWNKAL
FT                   AGHQRSSEELAQHLRASLDRFTDTFEQRSAGLLDGVSARLESTAGNVAQAWNEALARQE
FT                   SAGEKLAANNQQAFAAAAATFEQHAASLLRGVGQSHVDLQTELASKDEQRLAAWTETLG
FT                   AMAATLSKAWEQSGAQTASRQQEICETLAQTARDISAQTQAHASNTIAEIDRLVEAAAE
FT                   APKAAANLQAELASRDQQRLAAWTDTLAAMAATLSKEWAQSGAQTASRQQEICEALAQT
FT                   ARDISAQTQAHASNTIAEIDRLVQAAAEAPKAAANLQAELASRDQQRLAAWTEALGAMA
FT                   NTLSAEWEQAGARTASRQQEICETLAQTARDISAQTQAHASETIAEIGQLVQAASEAPK
FT                   AAAEVVAELRQKLSDSMVRDTAMLQERSRLLETLETLLDAVNHASTEQRTAVDALVATS
FT                   ADLLERVGTRFTDKLEHETGKLGSVAAQVTGSAVEVASLGEAFGTAVQVFGESNDKLVT
FT                   HLQRIETALDKSLARSDEQLAYYVAQAREVIDLSVMSQKQIVEDLQQLAGRRASAGVEA
FT                   A"
     MSRYRIDLVV FLAGLAAVCW IAAGYLGSNP LALAVTLLIG VCYLAGSLEL HRYNQATATL        60
     TQAVAGLSGP PPSLGTWLEP LHPSLRHAAR LRVEGERVAL PGPALTPYLV GLLVLLGMLG       120
     TLLGMVVTLR GTGMALESAT DLQAIRASLA APVKGLGFAF GTSIAGVATS AMLGLLSALC       180
     RRERLQAAQM LDVKIATILR IYSQSHQREE AFRLLQRQSE VMPTLVDRLQ TMMSAIEQQS       240
     LALNERQIAS QEAFHGRAEA AYTRLASSVE QSLKESVADS TRAAGAALQP VMQATMAGLA       300
     RETAVLHDTV THAVQRQLDG LSSGFETTTT TVADIWNKAL AGHQRSSEEL AQHLRASLDR       360
     FTDTFEQRSA GLLDGVSARL ESTAGNVAQA WNEALARQES AGEKLAANNQ QAFAAAAATF       420
     EQHAASLLRG VGQSHVDLQT ELASKDEQRL AAWTETLGAM AATLSKAWEQ SGAQTASRQQ       480
     EICETLAQTA RDISAQTQAH ASNTIAEIDR LVEAAAEAPK AAANLQAELA SRDQQRLAAW       540
     TDTLAAMAAT LSKEWAQSGA QTASRQQEIC EALAQTARDI SAQTQAHASN TIAEIDRLVQ       600
     AAAEAPKAAA NLQAELASRD QQRLAAWTEA LGAMANTLSA EWEQAGARTA SRQQEICETL       660
     AQTARDISAQ TQAHASETIA EIGQLVQAAS EAPKAAAEVV AELRQKLSDS MVRDTAMLQE       720
     RSRLLETLET LLDAVNHAST EQRTAVDALV ATSADLLERV GTRFTDKLEH ETGKLGSVAA       780
     QVTGSAVEVA SLGEAFGTAV QVFGESNDKL VTHLQRIETA LDKSLARSDE QLAYYVAQAR       840
     EVIDLSVMSQ KQIVEDLQQL AGRRASAGVE AA                                     872
//

If you have problems or comments...

PBIL Back to PBIL home page