(data stored in ACNUC7421 zone)

EMBL: CP001053.PE488

CP001053.PE488       Location/Qualifiers
FT   CDS             557767..558645
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4489"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="PFAM: regulatory protein LysR; LysR
FT                   substrate-binding; KEGG: bxe:Bxe_B0808 transcriptional
FT                   regulator, LysR family"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4489"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18863"
FT                   /db_xref="GOA:B2T7W1"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B2T7W1"
FT                   /protein_id="ACD18863.1"
FT                   /translation="MLNYRHLYYFWIVVKEGGFARAAERLDMAVQTISAQVRELEKSIG
FT                   RQLLKPAGRGVTMTEAGETAFNRAEQIFQLGEALLDDMREAGGEGVARLAVGLSDGISK
FT                   LAAHALLAPVLGTPSLRLLCHEGEHAELMSELALHRLDLVLACQPEPHNADLRVLSQRL
FT                   AGSPVDWYGPTGIVRKSARAGFPQCLAEVPVLLPTRHAALRARLDRWFDAQGIRPHIVG
FT                   EFEDSALMAVFAARGLGVFPLAELGAEDLSLLRGLRWLGRADGVIEEIHAIRSRRGQHH
FT                   GLASQVVAGAR"
     MLNYRHLYYF WIVVKEGGFA RAAERLDMAV QTISAQVREL EKSIGRQLLK PAGRGVTMTE        60
     AGETAFNRAE QIFQLGEALL DDMREAGGEG VARLAVGLSD GISKLAAHAL LAPVLGTPSL       120
     RLLCHEGEHA ELMSELALHR LDLVLACQPE PHNADLRVLS QRLAGSPVDW YGPTGIVRKS       180
     ARAGFPQCLA EVPVLLPTRH AALRARLDRW FDAQGIRPHI VGEFEDSALM AVFAARGLGV       240
     FPLAELGAED LSLLRGLRWL GRADGVIEEI HAIRSRRGQH HGLASQVVAG AR               292
//

If you have problems or comments...

PBIL Back to PBIL home page