(data stored in ACNUC7421 zone)

EMBL: CP001053.PE495

CP001053.PE495       Location/Qualifiers
FT   CDS             complement(563128..563865)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4496"
FT                   /product="two component transcriptional regulator, winged
FT                   helix family"
FT                   /note="PFAM: response regulator receiver; transcriptional
FT                   regulator domain protein; KEGG: bxe:Bxe_B0815 two component
FT                   transcriptional regulator, winged helix family"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4496"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18870"
FT                   /db_xref="GOA:B2TDY0"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:B2TDY0"
FT                   /protein_id="ACD18870.1"
FT                   /translation="MDNPKRILIVEDDIDIANVLSLHLRDERYEVVHSADGNEGLRLLE
FT                   QGGWDALILDLMLPGVDGLEICRRARAMTRYTPIIITSARSSEVHRILGLELGADDYLA
FT                   KPFSVLELVARVKALLRRVDALAKDSKIEAGSLRIAGLSIDPLTREAAVDGKPIELTPR
FT                   EFDLLYYFAQHPGKVFSRMDLLNAVWGYQHEGYEHTVNTHINRLRAKIEADPAQPERIL
FT                   TVWGRGYKLAVPGEPAGAPKDVS"
     MDNPKRILIV EDDIDIANVL SLHLRDERYE VVHSADGNEG LRLLEQGGWD ALILDLMLPG        60
     VDGLEICRRA RAMTRYTPII ITSARSSEVH RILGLELGAD DYLAKPFSVL ELVARVKALL       120
     RRVDALAKDS KIEAGSLRIA GLSIDPLTRE AAVDGKPIEL TPREFDLLYY FAQHPGKVFS       180
     RMDLLNAVWG YQHEGYEHTV NTHINRLRAK IEADPAQPER ILTVWGRGYK LAVPGEPAGA       240
     PKDVS                                                                   245
//

If you have problems or comments...

PBIL Back to PBIL home page