(data stored in ACNUC7421 zone)

EMBL: CP001053.PE496

CP001053.PE496       Location/Qualifiers
FT   CDS             563937..566012
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4497"
FT                   /product="Redoxin domain protein"
FT                   /note="PFAM: alkyl hydroperoxide reductase/ Thiol specific
FT                   antioxidant/ Mal allergen; cytochrome c biogenesis protein
FT                   transmembrane region; Redoxin domain protein; KEGG:
FT                   bxe:Bxe_B0816 putative transmembrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4497"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18871"
FT                   /db_xref="GOA:B2TDY5"
FT                   /db_xref="InterPro:IPR003834"
FT                   /db_xref="InterPro:IPR008979"
FT                   /db_xref="InterPro:IPR013740"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="InterPro:IPR041017"
FT                   /db_xref="UniProtKB/TrEMBL:B2TDY5"
FT                   /protein_id="ACD18871.1"
FT                   /translation="MAPLCKISGQRVITFNLTFREDFDTGGALGCGHFLQYQVLNELYA
FT                   GCRPSQRAHFNRPIRTFGTDMLLIVLAYLGGALTILSPCILPVLPFVFARADQPFVRSG
FT                   LPLLAGMALTFALVATLAAVGGGWVTQANQYGRWVAIALLAIFGLTLLFPRFADHLMRP
FT                   LVSAGNRLSNFAQTDGQQVRAGSSFLLGIATGLLWAPCAGPILGLVLTGAALRGASVGT
FT                   TLLLVAYAAGAATSLAVALLIGGKVFTAMKRSLGAGEWIRRGIGALMLCGVAAIALGFD
FT                   TGVLARVSTVATGGLEQKLVDKLSPNAAPGKAPVAGNAADASGGAMMSVNAASQSTAGA
FT                   DADSTAVNAAQGGAMMRTAVAAEAAPLPVEGVLPPLDGAVQWLNSPPLTTQDLRGKVVL
FT                   VDFWTYSCINCLRSLPYVKAWAQKYKDQGLVVIGVHAPEFAFERNIDNVKKATHDLGVD
FT                   YPVAIDNNYAIWRALNNQYWPAHYFVDAKGQIRYHHFGEGDYAGSEKVIQQLLTEAGHA
FT                   NASKVALGIANGGAQGVQAAADNADMQSPETYVGYQRAENFASPGGEVADKTHTYVAPS
FT                   QPGVNDWGLAGSWNVGAEHATLAASSGRIVYRFHARDLHLVLGPGKDGKPVRFRVSVDG
FT                   AAPGASHGTDVAADGSGTVTGQRLYQLVRQTGEVGDHTFSIEFLDPGVQAFAFTFG"
     MAPLCKISGQ RVITFNLTFR EDFDTGGALG CGHFLQYQVL NELYAGCRPS QRAHFNRPIR        60
     TFGTDMLLIV LAYLGGALTI LSPCILPVLP FVFARADQPF VRSGLPLLAG MALTFALVAT       120
     LAAVGGGWVT QANQYGRWVA IALLAIFGLT LLFPRFADHL MRPLVSAGNR LSNFAQTDGQ       180
     QVRAGSSFLL GIATGLLWAP CAGPILGLVL TGAALRGASV GTTLLLVAYA AGAATSLAVA       240
     LLIGGKVFTA MKRSLGAGEW IRRGIGALML CGVAAIALGF DTGVLARVST VATGGLEQKL       300
     VDKLSPNAAP GKAPVAGNAA DASGGAMMSV NAASQSTAGA DADSTAVNAA QGGAMMRTAV       360
     AAEAAPLPVE GVLPPLDGAV QWLNSPPLTT QDLRGKVVLV DFWTYSCINC LRSLPYVKAW       420
     AQKYKDQGLV VIGVHAPEFA FERNIDNVKK ATHDLGVDYP VAIDNNYAIW RALNNQYWPA       480
     HYFVDAKGQI RYHHFGEGDY AGSEKVIQQL LTEAGHANAS KVALGIANGG AQGVQAAADN       540
     ADMQSPETYV GYQRAENFAS PGGEVADKTH TYVAPSQPGV NDWGLAGSWN VGAEHATLAA       600
     SSGRIVYRFH ARDLHLVLGP GKDGKPVRFR VSVDGAAPGA SHGTDVAADG SGTVTGQRLY       660
     QLVRQTGEVG DHTFSIEFLD PGVQAFAFTF G                                      691
//

If you have problems or comments...

PBIL Back to PBIL home page