(data stored in ACNUC7421 zone)

EMBL: CP001053.PE497

CP001053.PE497       Location/Qualifiers
FT   CDS             566062..566802
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4498"
FT                   /product="peptide methionine sulfoxide reductase"
FT                   /EC_number="1.8.4.11"
FT                   /note="TIGRFAM: peptide methionine sulfoxide reductase;
FT                   PFAM: Methionine sulfoxide reductase A; KEGG: bxe:Bxe_B0817
FT                   peptide methionine sulfoxide reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4498"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18872"
FT                   /db_xref="GOA:B2TDY6"
FT                   /db_xref="InterPro:IPR002569"
FT                   /db_xref="InterPro:IPR036509"
FT                   /db_xref="UniProtKB/TrEMBL:B2TDY6"
FT                   /protein_id="ACD18872.1"
FT                   /translation="MRTISTRTASLRKRFSVTRIMGLVVVALGVVAAQHVAHSAEAATK
FT                   IPAPVQDEKAAATHSETAVFAGGCFWGVQGVFEHVRGVKQVASGYTGGAASTAQYEPVS
FT                   EGDTGHAESVQITYDPTQITYGRLLQIFFSVAHNPTELDYQGPDHGTQYRSAIFPVNAV
FT                   QRGIAQSYIAQLDSAHVFSAKVVTRVEDFKGFYPAESYHQNFLALHPDYPYIAINDLPK
FT                   VSDLKRMFPDLYRNDPVLFATASR"
     MRTISTRTAS LRKRFSVTRI MGLVVVALGV VAAQHVAHSA EAATKIPAPV QDEKAAATHS        60
     ETAVFAGGCF WGVQGVFEHV RGVKQVASGY TGGAASTAQY EPVSEGDTGH AESVQITYDP       120
     TQITYGRLLQ IFFSVAHNPT ELDYQGPDHG TQYRSAIFPV NAVQRGIAQS YIAQLDSAHV       180
     FSAKVVTRVE DFKGFYPAES YHQNFLALHP DYPYIAINDL PKVSDLKRMF PDLYRNDPVL       240
     FATASR                                                                  246
//

If you have problems or comments...

PBIL Back to PBIL home page